SAXSdb — 4glq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

Thermosynechococcus elongatus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	Phycoviolobilin, blue light-absorbing form × 1 water × 1	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	Phycoviolobilin, blue light-absorbing form × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DLC7_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–163； UniProt 430–591

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4glq
Deposition date deposition_date	2012-08-14
Structure title title	Crystal Structure of the blue-light absorbing form of the Thermosynechococcus elongatus PixJ GAF-domain
Keywords keywords	;chromophore, phytochrome, cyanobacteriochrome, phycoviolobilin, bilin, bili-protein, cation-pi interaction, signaling protein, GAF domain, photoreceptor, phycoviolobilin adduct ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4glq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4glq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4glq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.25 Å
Rg (electron density)	14.76 Å
Total Rg	15.95 Å
Atom count	1244
Residues	149
Excluded volume	22081 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4glq__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4glq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Methyl-accepting chemotaxis protein
Molecular weight formula_weight	19598.2 kDa
Mutation mutation	C555A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1442

MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASLHHHHHH

Source Source

Source organism organism	Thermosynechococcus elongatus
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	Phycoviolobilin, blue light-absorbing form
Molecular weight formula_weight	590.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	137

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d4glqa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.110 — Profilin-like
Superfamily Superfamily superfamily	d.110.2 — GAF domain-like
Family Family family	d.110.2.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	4glqA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	40 — GAF domain

▶

Unit-cell length a length_a	47.040 Å
Unit-cell length b length_b	47.040 Å
Unit-cell length c length_c	125.966 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.772 Å
Low-resolution limit resolution_low	44.068 Å
R factor r_factor	0.1590
R_work r_work	0.1546
R_free r_free	0.1996

Crystal Structure of the blue-light absorbing form of the Thermosynechococcus elongatus PixJ GAF-domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4glq__assembly_1__model_1

4glq__assembly_1__model_1 | I(q)

4glq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal Structure of the blue-light absorbing form of the Thermosynechococcus elongatus PixJ GAF-domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4glq__assembly_1__model_1

4glq__assembly_1__model_1 | I(q)

4glq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)