4he8

Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit 7

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO7_THET8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–119； UniProt 1–119 Author chain B； PDBConstruct 1–119； UniProt 1–119

NADH-quinone oxidoreductase subunit 10

OrganismNot specified

UniProt Q56225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO10_THET8
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–176； UniProt 1–176 Author chain J； PDBConstruct 1–176； UniProt 1–176

NADH-quinone oxidoreductase subunit 11

OrganismNot specified

UniProt Q56226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO11_THET8
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–95； UniProt 1–95 Author chain K； PDBConstruct 1–95； UniProt 1–95

NADH-quinone oxidoreductase subunit 12

OrganismNot specified

UniProt Q56227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO12_THET8
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–606； UniProt 1–606 Author chain L； PDBConstruct 1–606； UniProt 1–606

NADH-quinone oxidoreductase subunit 13

OrganismNot specified

UniProt Q56228

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO13_THET8
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–469； UniProt 1–469 Author chain M； PDBConstruct 1–469； UniProt 1–469

NADH-quinone oxidoreductase subunit 14

OrganismNot specified

UniProt Q56229

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 8 × 1 （Q60019） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO14_THET8
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–427； UniProt 1–427 Author chain N； PDBConstruct 1–427； UniProt 1–427

NADH-quinone oxidoreductase subunit 8

OrganismNot specified

UniProt Q60019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） UNDECYL-MALTOSIDE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit 7 × 1 （Q56217） NADH-quinone oxidoreductase subunit 10 × 1 （Q56225） NADH-quinone oxidoreductase subunit 11 × 1 （Q56226） NADH-quinone oxidoreductase subunit 12 × 1 （Q56227） NADH-quinone oxidoreductase subunit 13 × 1 （Q56228） NADH-quinone oxidoreductase subunit 14 × 1 （Q56229） UNDECYL-MALTOSIDE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NQO8_THET8
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–365； UniProt 1–365 Author chain H； PDBConstruct 1–365； UniProt 1–365

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4he8
Deposition date deposition_date	2012-10-03
Structure title title	Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus
Keywords keywords	NADH-quinone oxidoreductase, complex I, oxidoreductase, proton pump, membrane protein, NADH, menaquinone, cytoplasmic membrane; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4he8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4he8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4he8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.24 Å
Rg (electron density)	53.30 Å
Total Rg	52.95 Å
Atom count	16325
Residues	2143
Excluded volume	301560 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4he8__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4he8__assembly_2__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	NADH-quinone oxidoreductase subunit 7
Molecular weight formula_weight	13154.7 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	32650

MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH

Entity 2 Entity 2 polymer

Description description	NADH-quinone oxidoreductase subunit 10
Molecular weight formula_weight	18563.3 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,D

MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKASRAKEAEKREEVAR

Entity 3 Entity 3 polymer

Description description	NADH-quinone oxidoreductase subunit 11
Molecular weight formula_weight	10002.8 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,E

MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG

Entity 4 Entity 4 polymer

Description description	NADH-quinone oxidoreductase subunit 12
Molecular weight formula_weight	65189.9 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,F

MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIVTGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFIVNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALIHAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALFHVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGVGFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEVEAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGLLSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW

Entity 5 Entity 5 polymer

Description description	NADH-quinone oxidoreductase subunit 13
Molecular weight formula_weight	49247.1 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,G

MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIALTVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPMLAAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFAFFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGVYTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVIASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA

Entity 6 Entity 6 polymer

Description description	NADH-quinone oxidoreductase subunit 14
Molecular weight formula_weight	44463.9 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,I

MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSGRFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGSLVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALSVVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDPLLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARAAVVAAGVLLLALGLLPGLVLPALAAGG

Entity 7 Entity 7 polymer

Description description	NADH-quinone oxidoreductase subunit 8
Molecular weight formula_weight	41034.5 kDa
EC 编号 ec_number	1.6.5.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,C

MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLISYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIKWALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLWFLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA

Entity 8 Entity 8 non-polymer

Description description	UNDECYL-MALTOSIDE
Molecular weight formula_weight	496.6 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d4he8a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.73 — Non-antiporter membrane subunits from respiratory complex I
Superfamily Superfamily superfamily	f.73.3 — Respiratory complex I subunit NuoA-like
Family Family family	f.73.3.1 — Respiratory complex I subunit NuoA-like

Domain ID domain_id	d4he8c_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.72 — Antiporter-like subunits from respiratory complex I
Superfamily Superfamily superfamily	f.72.1 — Antiporter-like subunits from respiratory complex I
Family Family family	f.72.1.2 — Single antiporter-like subunits from respiratory complex I

Domain ID domain_id	d4he8j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.73 — Non-antiporter membrane subunits from respiratory complex I
Superfamily Superfamily superfamily	f.73.2 — Respiratory complex I subunit NuoJ-like
Family Family family	f.73.2.1 — Respiratory complex I subunit NuoJ-like

Domain ID domain_id	d4he8k_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.73 — Non-antiporter membrane subunits from respiratory complex I
Superfamily Superfamily superfamily	f.73.1 — Respiratory complex I subunit NuoK-like
Family Family family	f.73.1.1 — Respiratory complex I subunit NuoK-like

Domain ID domain_id	d4he8l_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.72 — Antiporter-like subunits from respiratory complex I
Superfamily Superfamily superfamily	f.72.1 — Antiporter-like subunits from respiratory complex I
Family Family family	f.72.1.1 — Double antiporter-like subunits from respiratory complex I

Domain ID domain_id	d4he8m_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.72 — Antiporter-like subunits from respiratory complex I
Superfamily Superfamily superfamily	f.72.1 — Antiporter-like subunits from respiratory complex I
Family Family family	f.72.1.1 — Double antiporter-like subunits from respiratory complex I

Domain ID domain_id	d4he8n_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.72 — Antiporter-like subunits from respiratory complex I
Superfamily Superfamily superfamily	f.72.1 — Antiporter-like subunits from respiratory complex I
Family Family family	f.72.1.1 — Double antiporter-like subunits from respiratory complex I

CATH v4.4 (8 domains)

Domain ID domain_id	4he8A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1610 — NADH:ubiquinone/plastoquinone oxidoreductase, chain 3

Domain ID domain_id	4he8B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1610 — NADH:ubiquinone/plastoquinone oxidoreductase, chain 3

Domain ID domain_id	4he8D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	4he8E00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

Domain ID domain_id	4he8F02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2700 —

Domain ID domain_id	4he8J00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	4he8K00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

Domain ID domain_id	4he8L02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2700 —

▶

Unit-cell length a length_a	85.260 Å
Unit-cell length b length_b	120.540 Å
Unit-cell length c length_c	176.660 Å
Unit-cell angle α angle_alpha	91.91 °
Unit-cell angle β angle_beta	95.73 °
Unit-cell angle γ angle_gamma	101.41 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	25.725 Å
R factor r_factor	0.2099
R_work r_work	0.2088
R_free r_free	0.2634

Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4he8__assembly_1__model_1

4he8__assembly_1__model_1 | I(q)

4he8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer