SAXSdb — 4hpm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BCL-6 corepressor-like protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Polycomb group RING finger protein 1 × 1 （Q9BSM1） PHOSPHATE ION × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Polycomb group RING finger protein 1 × 1 （Q9BSM1） PHOSPHATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCORL_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–122； UniProt 1594–1711 Author chain C； PDBConstruct 5–122； UniProt 1594–1711

Polycomb group RING finger protein 1

Homo sapiens

UniProt Q9BSM1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	BCL-6 corepressor-like protein 1 × 1 （Q5H9F3） PHOSPHATE ION × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	BCL-6 corepressor-like protein 1 × 1 （Q5H9F3） PHOSPHATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCGF1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–93； UniProt 167–255 Author chain D； PDBConstruct 5–93； UniProt 167–255

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4hpm
Deposition date deposition_date	2012-10-24
Structure title title	PCGF1 Ub fold (RAWUL)/BCORL1 PUFD Complex
Keywords keywords	;POLYCOMB, BCORL1, PCGF1, RAWUL, NSPC1, E3-LIGASE, CHROMOSOMAL PROTEIN, TRANSCRIPTION REGULATION, CHROMATIN REGULATOR, TRANSCRIPTION REPRESSOR, LIGASE, METAL-BINDING, NUCLEUS, REPRESSOR, TRANSCRIPTION, UBL CONJUGATION PATHWAY, ZINC-FINGER ;; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4hpm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4hpm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4hpm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.16 Å
Rg (electron density)	18.01 Å
Total Rg	19.01 Å
Atom count	1642
Residues	199
Excluded volume	29204 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4hpm__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4hpm__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	BCL-6 corepressor-like protein 1
Molecular weight formula_weight	14023.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	3487

METRDDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHFEITTMPKAEFYRQVASSQLLTPAERPGGLDDRSPPGSSETVELVRYEPDLLRLLGSEVEFQSCNS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Polycomb group RING finger protein 1
Molecular weight formula_weight	11074.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

QGTREQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	262

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4hpmA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	260 — Mlu1-box Binding Protein; DNA-binding Domain
Homologous superfamily homologous superfamily	40 — BCL-6 corepressor, PCGF1 binding domain

Domain ID domain_id	4hpmB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4hpmC00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	260 — Mlu1-box Binding Protein; DNA-binding Domain
Homologous superfamily homologous superfamily	40 — BCL-6 corepressor, PCGF1 binding domain

Domain ID domain_id	4hpmD00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

▶

Unit-cell length a length_a	52.784 Å
Unit-cell length b length_b	65.794 Å
Unit-cell length c length_c	56.517 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.73 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	19.710 Å
R factor r_factor	0.2021
R_work r_work	0.1992
R_free r_free	0.2469

PCGF1 Ub fold (RAWUL)/BCORL1 PUFD Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

BCL-6 corepressor-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Polycomb group RING finger protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4hpm__assembly_1__model_1

4hpm__assembly_1__model_1 | I(q)

4hpm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

PCGF1 Ub fold (RAWUL)/BCORL1 PUFD Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

BCL-6 corepressor-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polycomb group RING finger protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4hpm__assembly_1__model_1

4hpm__assembly_1__model_1 | I(q)

4hpm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)