4hre

Crystal Structure of p11/Annexin A2 Heterotetramer in Complex with SMARCA3 Peptide

Method: X-RAY DIFFRACTION D_max: 216.6 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Annexin A2

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–339 Chain C； UniProt 1–339	Not recorded	Protein S100-A10 × 2 （P60903） Helicase-like transcription factor × 2 （Q14527）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain B； UniProt 1–339 Chain D； UniProt 1–339	Not recorded	Protein S100-A10 × 2 （P60903） Helicase-like transcription factor × 2 （Q14527）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	ANXA2_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–339； UniProt 1–339 Author chain B； PDBConstruct 1–339； UniProt 1–339 Author chain C； PDBConstruct 1–339； UniProt 1–339 Author chain D； PDBConstruct 1–339； UniProt 1–339

Protein S100-A10

Homo sapiens

UniProt P60903

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain E； UniProt 2–97 Chain F； UniProt 2–97	Not recorded	Annexin A2 × 2 （P07356） Helicase-like transcription factor × 2 （Q14527）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain I； UniProt 2–97 Chain J； UniProt 2–97	Not recorded	Annexin A2 × 2 （P07356） Helicase-like transcription factor × 2 （Q14527）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4HRE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A4P P11 (S100A10), LIGAND OF ANNEXIN II Deposited 1998-01-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–96（96 aa） Chain B 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；15 MG/ML PROTEIN WERE CRYSTALLIZED BY VAPOR DIFFUSION AGAINST 20% PEG 4000, 10% 2-PROPANOL, 100MM HEPES, PH=7.5, vapor diffusion	Resolution 2.25 Å R-free 0.303
1A4P P11 (S100A10), LIGAND OF ANNEXIN II Deposited 1998-01-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–96（96 aa） Chain B 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；15 MG/ML PROTEIN WERE CRYSTALLIZED BY VAPOR DIFFUSION AGAINST 20% PEG 4000, 10% 2-PROPANOL, 100MM HEPES, PH=7.5, vapor diffusion	Resolution 2.25 Å R-free 0.303
1BT6 P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS Deposited 1998-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–96（96 aa） Chain B 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.40 Å R-free 0.307
1BT6 P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS Deposited 1998-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–96（96 aa） Chain B 1–96（96 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.40 Å R-free 0.307
4DRW Crystal Structure of the Ternary Complex between S100A10, an Annexin A2 N-terminal Peptide and an AHNAK Peptide Deposited 2012-02-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–93（93 aa） Fragment：UNP P60903 residues 1-93 and UNP P07355 residues 2-16 Chain B 1–93（93 aa） Fragment：UNP P60903 residues 1-93 and UNP P07355 residues 2-16	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；100mM sodium chloride, 200mM magnesium chloride, 50mM sodium cacodylate, 20% PEG 1000, 0.15mM CYMAL-7, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.50 Å R-free 0.327
4DRW Crystal Structure of the Ternary Complex between S100A10, an Annexin A2 N-terminal Peptide and an AHNAK Peptide Deposited 2012-02-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–93（93 aa） Fragment：UNP P60903 residues 1-93 and UNP P07355 residues 2-16 Chain D 1–93（93 aa） Fragment：UNP P60903 residues 1-93 and UNP P07355 residues 2-16	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；100mM sodium chloride, 200mM magnesium chloride, 50mM sodium cacodylate, 20% PEG 1000, 0.15mM CYMAL-7, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.50 Å R-free 0.327
4FTG The crystal structure of an AHNAK peptide in complex with the S100A10/AnxA2 heterotetramer Deposited 2012-06-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 2–97（96 aa） Chain B 2–97（96 aa）	Not recorded	IPA ISOPROPYL ALCOHOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；290 K；20% PEG 8000 (w/v), 0.1 M Tris pH 8.5, 10% 2-propanol, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.51 Å R-free 0.251
4HRG Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with AHNAK1 Peptide Deposited 2012-10-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–94（94 aa） Chain B 1–94（94 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293 K；0.1 M Tris, 30 % PEG 6000, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.00 Å R-free 0.217
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–93（93 aa） Chain B 1–93（93 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–93（93 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–93（93 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–93（93 aa） Chain B 1–93（93 aa）	Not recorded	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263

6 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	S10AA_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 2–97； UniProt 2–97 Author chain F； PDBConstruct 2–97； UniProt 2–97 Author chain I； PDBConstruct 2–97； UniProt 2–97 Author chain J； PDBConstruct 2–97； UniProt 2–97

Helicase-like transcription factor

OrganismNot specified

UniProt Q14527

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain G； UniProt 26–39 Chain H； UniProt 26–39	Not recorded	Annexin A2 × 2 （P07356） Protein S100-A10 × 2 （P60903）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain K； UniProt 26–39 Chain L； UniProt 26–39	Not recorded	Annexin A2 × 2 （P07356） Protein S100-A10 × 2 （P60903）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 3.7；293 K；0.1 M citric acid, 25% PEG 3350, pH 3.7, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.79 Å R-free 0.296

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4HRE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2MZN NMR structure of the HLTF HIRAN domain in its DNA-bound conformation Deposited 2015-02-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 51–171（121 aa） Fragment：UNP residues 51-171	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) 0.1；Pressure ambient NMR sample composition 1 mM [U-13C; U-15N] protein, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 26–39（14 aa） Chain D 26–39（14 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 26–39（14 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 26–39（14 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4HRH Crystal Structure of p11-Annexin A2(N-terminal) Fusion Protein in Complex with SMARCA3 Peptide Deposited 2012-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–39（14 aa） Chain D 26–39（14 aa）	Not recorded	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M MES, 1.6 M (NH4)2SO4, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 3.00 Å R-free 0.263
4S0N Crystal Structure of HLTF HIRAN Domain bound to DNA Deposited 2015-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 55–180（126 aa） Fragment：HIRAN Domain, UNP residues 55-180 Chain B 55–180（126 aa） Fragment：HIRAN Domain, UNP residues 55-180 Chain C 55–180（126 aa） Fragment：HIRAN Domain, UNP residues 55-180 Chain D 55–180（126 aa） Fragment：HIRAN Domain, UNP residues 55-180	Not recorded	TMP THYMIDINE-5'-PHOSPHATE × 2 GOL GLYCEROL × 2 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289.15 K；25% PEG 4000, 250 mM sodium acetate trihydrate, 100 mM Tris-HCl pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 289.15K	Resolution 1.50 Å R-free 0.185
4XZF Crystal structure of HIRAN domain of human HLTF in complex with DNA Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 58–174（117 aa） Fragment：UNP residues 58-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350, Na acetate	Resolution 1.38 Å R-free 0.207
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
4XZG Crystal structure of HIRAN domain of human HLTF Deposited 2015-02-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 57–174（118 aa） Fragment：UNP residues 57-174	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG 3350	Resolution 2.40 Å R-free 0.231
5BNH Crystal structure of the HLTF HIRAN domain with a ssDNA fragment Deposited 2015-05-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 55–175（121 aa） Fragment：UNP residues 55-175 Chain D 55–175（121 aa） Fragment：UNP residues 55-175	Not recorded	NA SODIUM ION × 2 PO4 PHOSPHATE ION × 2 ACT ACETATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；291 K；0.1 M Sodium acetate trihydrate pH 5.0, 40% 2-Methyl-2,4-pentanediol	Resolution 1.70 Å R-free 0.214
5K5F NMR structure of the HLTF HIRAN domain Deposited 2016-05-23	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 51–171（121 aa） Fragment：residues 51-171	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR sample composition 1 mM [U-99% 13C; U-99% 15N] HLTF HIRAN domain, 20 mM sodium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6KCS Crystal structure of HIRAN domain of HLTF in complex with duplex DNA Deposited 2019-06-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 58–174（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；PEG	Resolution 2.10 Å R-free 0.264

8 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HLTF_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–14； UniProt 26–39 Author chain H； PDBConstruct 1–14； UniProt 26–39 Author chain K； PDBConstruct 1–14； UniProt 26–39 Author chain L； PDBConstruct 1–14； UniProt 26–39

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4hre
Deposition date deposition_date	2012-10-27
Structure title title	Crystal Structure of p11/Annexin A2 Heterotetramer in Complex with SMARCA3 Peptide
Keywords keywords	Calcium Binding, Nucleus, Calcium-binding protein; Calcium-binding protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	59.50 Å
Radius of gyration Rg (electron density) rg_electron	61.43 Å
Forward intensity I(0) i0	578517000.00
Molecular weight molecular_weight	200730.0 kDa
Excluded volume excluded_volume	252120 Å³
Envelope volume envelope_volume	370360 Å³
Hydration-shell volume shell_volume	60662 Å³
Envelope diameter envelope_diameter	237.6 Å
Shell Rg shell_rg	47.89 Å
Envelope Rg envelope_rg	61.86 Å
Shape Rg shape_rg	61.43 Å
Total Rg total_rg	60.95 Å
Total atoms total_atoms	14088
Residues n_residues	1752
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	216.6 Å
Rg (real space) rg_real	60.92 Å
Rg uncertainty (real space) rg_real_error	2.62 Å
I(0) (real space) i0_real	5.7840e+08
I(0) uncertainty (real space) i0_real_error	1.2970e+07
Rg (reciprocal space) rg_reciprocal	58.28 Å
I(0) (reciprocal space) i0_reciprocal	576100000.0000
Solution quality estimate total_estimate	0.5240
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	41.6 Å
Skewness Skewness skewness	0.794
Kurtosis Kurtosis kurtosis	0.155
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0008
Highest regularization parameter α highest_alpha	21830000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.514; Stabil: 0.999; Sysdev: 0.025; Positv: 1.000; Valcen: 0.676; Smooth: 0.517

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Annexin A2
Molecular weight formula_weight	38733.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,B,D
Atom count atom_count	14088

MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNILTNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein S100-A10
Molecular weight formula_weight	11176.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,I,J

SPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Helicase-like transcription factor
Molecular weight formula_weight	1806.1 kDa
EC 编号 ec_number	3.6.4.-, 6.3.2.-
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,K,L

PRLSYPTFFPRFEF

▼

7. Fold Classification (SCOP + CATH) 20 domains

CATH v4.4 (20 domains)

Domain ID domain_id	4hreA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreA03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreA04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreB04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreC03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreC04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreD02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreD03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreD04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	10 — Annexin

Domain ID domain_id	4hreE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4hreF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4hreI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4hreJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

8. Citations (1)

▶

Unit-cell length a length_a	50.791 Å
Unit-cell length b length_b	74.346 Å
Unit-cell length c length_c	154.466 Å
Unit-cell angle α angle_alpha	90.14 °
Unit-cell angle β angle_beta	96.56 °
Unit-cell angle γ angle_gamma	108.37 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.785 Å
Low-resolution limit resolution_low	47.335 Å
R factor r_factor	0.2567
R_work r_work	0.2490
R_free r_free	0.2960

fit	/app/data/saxs_computation/hr/4hre/4hre.fit
pddf	/app/data/pr_computation/hr/4hre/4hre.pr.out
profile	/app/data/saxs_computation/hr/4hre/4hre.dat

Crystal Structure of p11/Annexin A2 Heterotetramer in Complex with SMARCA3 Peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Annexin A2

State in the Current Structure

Other States of the Same Protein in the Database

Protein S100-A10

State in the Current Structure

Other States of the Same Protein in the Database

Helicase-like transcription factor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 20 domains

CATH v4.4 (20 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)