SAXSdb — 4icg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein H-NS

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors) × 2 （Q7CR17）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HNS_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–46； UniProt 3–46 Author chain B； PDBConstruct 3–46； UniProt 3–46

Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors)

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

UniProt Q7CR17

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DNA-binding protein H-NS × 2 （P0A1S2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7CR17_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 5–75； UniProt 2–72 Author chain D； PDBConstruct 5–75； UniProt 2–72

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4icg
Deposition date deposition_date	2012-12-10
Structure title title	N-terminal dimerization domain of H-NS in complex with Hha (Salmonella Typhimurium)
Keywords keywords	DNA binding protein, Hha; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4icg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4icg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4icg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.07 Å
Rg (electron density)	19.23 Å
Total Rg	20.06 Å
Atom count	1688
Residues	217
Excluded volume	29883 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4icg__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	DNA-binding protein H-NS
Molecular weight formula_weight	5459.9 kDa
Mutation mutation	S2G
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A
Atom count atom_count	1688

MGEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESA

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors)
Molecular weight formula_weight	9051.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GSHMSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4icgc_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.5 — Hemolysin expression modulating protein HHA
Family Family family	a.23.5.1 — Hemolysin expression modulating protein HHA

Domain ID domain_id	d4icgd_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.5 — Hemolysin expression modulating protein HHA
Family Family family	a.23.5.1 — Hemolysin expression modulating protein HHA

CATH v4.4 (4 domains)

Domain ID domain_id	4icgA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1050 — H-NS histone-like proteins

Domain ID domain_id	4icgB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1050 — H-NS histone-like proteins

Domain ID domain_id	4icgC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	40 — HHA

Domain ID domain_id	4icgD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	40 — HHA

▶

Unit-cell length a length_a	77.880 Å
Unit-cell length b length_b	82.900 Å
Unit-cell length c length_c	47.130 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.922 Å
Low-resolution limit resolution_low	47.130 Å
R factor r_factor	0.2829
R_work r_work	0.2772
R_free r_free	0.3315

N-terminal dimerization domain of H-NS in complex with Hha (Salmonella Typhimurium)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein H-NS

State in the Current Structure

Other States of the Same Protein in the Database

Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4icg__assembly_1__model_1

4icg__assembly_1__model_1 | I(q)

4icg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)

N-terminal dimerization domain of H-NS in complex with Hha (Salmonella Typhimurium)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein H-NS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hemolysin expression modulating protein (Involved in environmental regulation of virulence factors)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4icg__assembly_1__model_1

4icg__assembly_1__model_1 | I(q)

4icg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)