4idw

Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution and Novel Structure Refinement Strategy

Method: POWDER DIFFRACTION D_max: 47.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 85–105 Chain B； UniProt 25–54	Not recorded	ZN ZINC ION × 3	POWDER DIFFRACTION X-ray crystallization conditions：Batch；pH 6；295 K；polycrystalline samples of T6 hexameric insulin (Zn2[(AB)2]3, the pH was adjusted by mixing different ratios of 0.2M solutions of sodium monobasic monohydrate phosphate and potassium phosphate., Batch, temperature 295K	Resolution 2.70 Å
2	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain C； UniProt 85–105 Chain D； UniProt 25–54	Not recorded	ZN ZINC ION × 3	POWDER DIFFRACTION X-ray crystallization conditions：Batch；pH 6；295 K；polycrystalline samples of T6 hexameric insulin (Zn2[(AB)2]3, the pH was adjusted by mixing different ratios of 0.2M solutions of sodium monobasic monohydrate phosphate and potassium phosphate., Batch, temperature 295K	Resolution 2.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4IDW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1APH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1BPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 3 DCE 1,2-DICHLOROETHANE × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1CPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 1 DCE 1,2-DICHLOROETHANE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1DPH CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 Deposited 1992-10-30	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	NA SODIUM ION × 2 DCE 1,2-DICHLOROETHANE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1HO0 NEW B-CHAIN MUTANT OF BOVINE INSULIN Deposited 2000-12-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 25–54（30 aa） Fragment：B-CHAIN	Mutation：C7S, C19S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 3.6；293 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR sample composition 0.5 mM peptide concentration \| 70 % H2O / 30 % deuterated TFE	Resolution not provided
1PID BOVINE DESPENTAPEPTIDE INSULIN Deposited 1995-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–49（25 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å
1PID BOVINE DESPENTAPEPTIDE INSULIN Deposited 1995-11-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–49（25 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å
2A3G The structure of T6 bovine insulin Deposited 2005-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Fragment：insulin A chain, residues 85-105 Chain B 25–54（30 aa） Fragment：insulin B chain, residues 25-54 Chain C 85–105（21 aa） Fragment：insulin A chain, residues 85-105 Chain D 25–54（30 aa） Fragment：insulin B chain, residues 25-54	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；298 K；HCl, ZINC ACETATE, SODIUM CITRATE, ACETONE, pH 6.2, SLOW COOLING, temperature 298 K, pH 6.20	Resolution 2.25 Å R-free 0.219
2BN1 Insulin after a high dose x-ray burn Deposited 2005-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN, RESIDUES 85-105 Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN, RESIDUES 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions .4 M NAPO4/NA2HPO4 PH10.4, 0.001M EDTA, 30% ETHYLENE GLYCOL	Resolution 1.40 Å R-free 0.165
2BN3 Insulin before a high dose x-ray burn Deposited 2005-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN, RESIDUES 85-105 Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN, RESIDUES 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.4 M NAPO4/NA2HPO4 PH 10.4, 0.001 M EDTA,30%ETHYLENE GLYCOL	Resolution 1.40 Å R-free 0.161
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 26–54（29 aa） Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 26–54（29 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 26–54（29 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2INS THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN Deposited 1982-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 26–54（29 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
2ZP6 Crystal structure of Bovine Insulin (Hexameric form) Deposited 2008-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa） Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；15% acetone, 0.6M Ammonium formate (metal basis), 0.6M sodium citrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.56 Å R-free 0.220
4BS3 Bovin insulin structure determined by in situ crystal analysis and sulfur-SAD phasing at room temperature Deposited 2013-06-06	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.2；293 K；INSULIN (30 MG/ML) WAS CRYSTALLIZED AT 293K BY VAPOR DIFFUSION (SITTING DROP) IN CRYSTALQUICK X MICROPLATE USING A RESERVOIR SOLUTION CONTAINING 0.275 M NAHPO4 / NA3PO4 PH 10.2, 0.01 M NA3EDTA.	Resolution 2.30 Å R-free 0.169
4E7T The structure of T6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；0.05M sodium citrate, 0.5mM zinc acetate, 15% acetone, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.40 Å R-free 0.229
4E7T The structure of T6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；0.05M sodium citrate, 0.5mM zinc acetate, 15% acetone, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.40 Å R-free 0.229
4E7U The structure of T3R3 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH METHOD；pH 6.4；298 K；6.5mg/ml bovine insulin, 7mM zinc acetate, 0.05M sodium citrate, 15% acetone, 0.2M KSCN, pH 6.4, BATCH METHOD, temperature 298K	Resolution 1.30 Å R-free 0.179
4E7U The structure of T3R3 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1 SCN THIOCYANATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH METHOD；pH 6.4；298 K；6.5mg/ml bovine insulin, 7mM zinc acetate, 0.05M sodium citrate, 15% acetone, 0.2M KSCN, pH 6.4, BATCH METHOD, temperature 298K	Resolution 1.30 Å R-free 0.179
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain 1 85–105（21 aa） Chain 2 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 10 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain O 85–105（21 aa） Chain P 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 11 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain Q 85–105（21 aa） Chain R 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 12 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain S 85–105（21 aa） Chain T 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 13 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain U 85–105（21 aa） Chain V 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 14 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain W 85–105（21 aa） Chain X 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 15 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain 3 85–105（21 aa） Chain 4 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 16 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain 5 85–105（21 aa） Chain 6 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 17 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain 1 85–105（21 aa） Chain 2 25–54（30 aa） Chain Y 85–105（21 aa） Chain Z 25–54（30 aa）	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 18 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain 3 85–105（21 aa） Chain 4 25–54（30 aa） Chain 5 85–105（21 aa） Chain 6 25–54（30 aa）	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 19 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain M 85–105（21 aa） Chain N 25–54（30 aa） Chain O 85–105（21 aa） Chain P 25–54（30 aa） Chain Q 85–105（21 aa） Chain R 25–54（30 aa） Chain S 85–105（21 aa） Chain T 25–54（30 aa） Chain U 85–105（21 aa） Chain V 25–54（30 aa） Chain W 85–105（21 aa） Chain X 25–54（30 aa）	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 20 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa） Chain C 85–105（21 aa） Chain D 25–54（30 aa） Chain E 85–105（21 aa） Chain F 25–54（30 aa） Chain G 85–105（21 aa） Chain H 25–54（30 aa） Chain I 85–105（21 aa） Chain J 25–54（30 aa） Chain K 85–105（21 aa） Chain L 25–54（30 aa）	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 85–105（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 85–105（21 aa） Chain H 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 85–105（21 aa） Chain J 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain K 85–105（21 aa） Chain L 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 8 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain Y 85–105（21 aa） Chain Z 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4E7V The structure of R6 bovine insulin Deposited 2012-03-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 9 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain M 85–105（21 aa） Chain N 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2 ul 5 mg/ml bovine insulin + 2 ul reservoir equilibrated against 1 ml reservoir of: 0.12 M sodium citrate, 17 mM zinc acetate, 22% acetone, 0.5% m-cresol, 1.67 M NaCl, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.272
4I5Y Insulin protein crystallization via langmuir-blodgett Deposited 2012-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：UNP residues 85-105 Chain B 25–54（30 aa） Fragment：UNP residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.222
4I5Z Insulin protein crystallization via langmuir-blodgett Deposited 2012-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：UNP residues 85-105 Chain B 25–54（30 aa） Fragment：UNP residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.218
4IHN High Resolution Insulin by Langmuir-Blodgett Modified Hanging Drop Vapour Diffusion Deposited 2012-12-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.16 Å R-free 0.260
4M4F Radiation damage study of Cu T6-insulin - 0.01 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：Insulin A chain (UNP residues 85-105) Chain B 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.235
4M4F Radiation damage study of Cu T6-insulin - 0.01 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：Insulin A chain (UNP residues 85-105) Chain D 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.235
4M4H Radiation damage study of Cu T6-insulin - 0.06 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4H Radiation damage study of Cu T6-insulin - 0.06 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4I Radiation damage study of Cu T6-insulin - 0.12 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.202
4M4I Radiation damage study of Cu T6-insulin - 0.12 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.202
4M4J Radiation damage study of Cu T6-insulin - 0.30 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4J Radiation damage study of Cu T6-insulin - 0.30 MGy Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.220
4M4L The structure of Cu T6 bovine insulin Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.204
4M4L The structure of Cu T6 bovine insulin Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	CU COPPER (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.1；298 K；0.05M sodium citrate, 15%(v/v) acetone, 7.5mM copper(II)acetate, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.204
4M4M The structure of Ni T6 bovine insulin Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain B 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；298 K；0.05M sodium citrate, 15%(v/v) acetone, 15mM nickel(II)acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.224
4M4M The structure of Ni T6 bovine insulin Deposited 2013-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 85–105（21 aa） Fragment：INSULIN A CHAIN (UNP RESIDUES 85-105) Chain D 25–54（30 aa） Fragment：INSULIN B CHAIN (UNP RESIDUES 25-54)	Not recorded	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；298 K；0.05M sodium citrate, 15%(v/v) acetone, 15mM nickel(II)acetate, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.224
5AZZ Crystal structure of seleno-insulin Deposited 2015-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Mutation：C7(SEC) Mutation：C7(SEC)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；Sodium chloride, ethylene imine polymer, citrate	Resolution 1.45 Å R-free 0.192
5KQV Insulin receptor ectodomain construct comprising domains L1,CR,L2, FnIII-1 and alphaCT peptide in complex with bovine insulin and FAB 83-14 (REVISED STRUCTURE) Deposited 2016-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 85–105（21 aa） Fragment：UNP Residues 85-105 Chain B 25–54（30 aa） Fragment：UNP Residues 25-54 Chain I 85–105（21 aa） Fragment：UNP Residues 85-105 Chain J 25–54（30 aa） Fragment：UNP Residues 25-54	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；9% POLYETHYLENE GLYCOL 3350, 200MM PROLINE, 100MM HEPES/NAOH, PH 7.5	Resolution 4.40 Å R-free 0.266
5MIZ MD ensemble of bovine insulin Deposited 2016-11-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 2.86；293 K；Ionic strength (raw mmCIF value) 1.4；Pressure 1 NMR measurement conditions pH 2.86；308 K；Ionic strength (raw mmCIF value) 1.4；Pressure 1 NMR sample composition 1.1 mM Bovine insulin, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6KH8 Solution structure of Zn free Bovine Pancreatic Insulin in 20% acetic acid-d4 (pH 1.9) Deposited 2019-07-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% ACETIC ACID；Pressure 1 NMR sample composition 350 uM Bovine insulin Chain A, 350 uM Bovine Insulin chain B, 20% acetic acid-D4 \| 20% acetic acid-D4	Resolution not provided
6KH9 Solution structure of bovine insulin amyloid intermediate-1 Deposited 2019-07-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% Acetic acid-d4；Pressure ambient NMR sample composition 350 uM Bovine insulin, 20% acetic acid-d4 \| 20% acetic acid-d4	Resolution not provided
6KHA Solution structure of bovine insulin amyloid intermediate-2 Deposited 2019-07-14	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 1.9；298 K；Ionic strength (raw mmCIF value) 20% Acetic acid-d4；Pressure AMBIENT NMR sample composition 350 uM NONE BOVINE INSULIN, 20% ACETIC ACID D4 \| 20% ACETIC ACID D4	Resolution not provided
6OR0 Crystal structure of Insulin from Non-merohedrally twinned crystals Deposited 2019-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–53（29 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.2 M Na2HPO4/Na3PO4, pH 10.0 and 0.01 M Na EDTA	Resolution 1.55 Å R-free 0.215
6Q8Q Bovine Insulin under 2 kbar of argon Deposited 2018-12-16	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	AR ARGON × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；PROTEIN DROP: 10 MG/ML. RESERVOIR: 1.2 M TMAO + 0.1 M SODIUM MALATE, PH 5.5	Resolution 2.00 Å R-free 0.199
6QQ7 Bovine insulin at ambient pressure Deposited 2019-02-18	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na2HPO4, 0.1 M Na2EDTA	Resolution 1.65 Å R-free 0.190
6QQG High pressure structure of bovine insulin (60 MPa) Deposited 2019-02-18	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na3EDTA, 0.1 M Na2HPO4	Resolution 2.15 Å R-free 0.176
6QRH High pressure structure of bovine insulin (100 MPa) Deposited 2019-02-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 M Na3 EDTA, 0.1 M Na2HEDTA	Resolution 2.15 Å R-free 0.232
6QRK High pressure structure of bovine insulin (200 MPa) Deposited 2019-02-19	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.01 Na3EDTA, 0.1 MNa2HEDTA	Resolution 2.10 Å R-free 0.248
6ZHB 3D electron diffraction structure of bovine insulin Deposited 2020-06-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 85–105（21 aa） Chain B 25–54（30 aa） Chain C 85–105（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	ELECTRON CRYSTALLOGRAPHY cryo-EM buffer pH 6.5；MES buffer, 50 mM cryo-EM vitrification conditions Cryogen ETHANE；Manual plunger	Resolution 3.25 Å R-free 0.319
6ZI8 X-ray diffraction structure of bovine insulin at 2.3 A resolution Deposited 2020-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–105（105 aa） Chain B 1–105（105 aa） Chain C 1–105（105 aa） Chain D 1–105（105 aa）	Not recorded	ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；pH 6.5；293 K；50mM MES pH 6.5, 10mM ZnCl2, 10mM NaCl in double-distilled water	Resolution 2.30 Å R-free 0.238
7ELJ Prion Derived Tetrapeptide Stabilizes Thermolabile Insulin via Conformational Trapping Deposited 2021-04-11	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 85–105（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 2.6；298 K；Ionic strength (raw mmCIF value) 1；Pressure 1 NMR sample composition 1 mM Proton Bovine Insulin, 1 mM Proton-15N, 13C Peptide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

39 other PDB entries and 85 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	INS_BOVIN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 85–105 Author chain C； PDBConstruct 1–21； UniProt 85–105 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4idw
Deposition date deposition_date	2012-12-13
Structure title title	Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution and Novel Structure Refinement Strategy
Keywords keywords	HORMONE, INSULIN FAMILY, CARBOHYDRATE METABOLISM, HORMONE-GROWTH, T6 Bovine Insulin; HORMONE
Experimental Method method	POWDER DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.84 Å
Radius of gyration Rg (electron density) rg_electron	13.66 Å
Forward intensity I(0) i0	2954530.00
Molecular weight molecular_weight	11606.0 kDa
Excluded volume excluded_volume	14290 Å³
Envelope volume envelope_volume	16356 Å³
Hydration-shell volume shell_volume	10562 Å³
Envelope diameter envelope_diameter	45.7 Å
Shell Rg shell_rg	18.86 Å
Envelope Rg envelope_rg	14.00 Å
Shape Rg shape_rg	13.62 Å
Total Rg total_rg	14.86 Å
Total atoms total_atoms	802
Residues n_residues	102
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	47.2 Å
Rg (real space) rg_real	14.79 Å
Rg uncertainty (real space) rg_real_error	0.27 Å
I(0) (real space) i0_real	2.9550e+06
I(0) uncertainty (real space) i0_real_error	3.3290e+04
Rg (reciprocal space) rg_reciprocal	14.80 Å
I(0) (reciprocal space) i0_reciprocal	2955000.0000
Solution quality estimate total_estimate	0.8172
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	17.9 Å
Skewness Skewness skewness	0.240
Kurtosis Kurtosis kurtosis	-0.330
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	306300.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.874; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Insulin A chain
Molecular weight formula_weight	2339.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	846

GIVEQCCASVCSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin B chain
Molecular weight formula_weight	3403.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	44

▶

8. Citations (1)

▶

Unit-cell length a length_a	82.607 Å
Unit-cell length b length_b	82.607 Å
Unit-cell length c length_c	33.632 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

fit	/app/data/saxs_computation/id/4idw/4idw.fit
pddf	/app/data/pr_computation/id/4idw/4idw.pr.out
profile	/app/data/saxs_computation/id/4idw/4idw.dat

Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution and Novel Structure Refinement Strategy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)