SAXSdb — 4j2l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ataxin-1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein capicua homolog × 1 （Q96RK0）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein capicua homolog × 1 （Q96RK0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATX1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–129； UniProt 562–688 Author chain B； PDBConstruct 3–129； UniProt 562–688

Protein capicua homolog

Homo sapiens

UniProt Q96RK0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Ataxin-1 × 1 （P54253）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Ataxin-1 × 1 （P54253）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIC_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–28； UniProt 21–48 Author chain D； PDBConstruct 1–28； UniProt 21–48

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4j2l
Deposition date deposition_date	2013-02-04
Structure title title	Crystal Structure of AXH domain complexed with Capicua
Keywords keywords	AXH domain, homodimerization protein-protein interaction, Capciua, ATXN1, TRANSCRIPTION REGULATOR; TRANSCRIPTION REGULATOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4j2l__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4j2l__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4j2l__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.49 Å
Rg (electron density)	17.75 Å
Total Rg	18.78 Å
Atom count	1145
Residues	146
Excluded volume	20576 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4j2l__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4j2l__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Ataxin-1
Molecular weight formula_weight	14120.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2302

EFSPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein capicua homolog
Molecular weight formula_weight	3244.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MFVWTNVEPRSVAVFPWHSLVPFLAPSQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4j2la_
Class class	b — All beta proteins
Fold Fold fold	b.145 — AXH domain
Superfamily Superfamily superfamily	b.145.1 — AXH domain
Family Family family	b.145.1.1 — AXH domain

Domain ID domain_id	d4j2lb_
Class class	b — All beta proteins
Fold Fold fold	b.145 — AXH domain
Superfamily Superfamily superfamily	b.145.1 — AXH domain
Family Family family	b.145.1.1 — AXH domain

▶

Unit-cell length a length_a	53.500 Å
Unit-cell length b length_b	53.500 Å
Unit-cell length c length_c	276.212 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43 2 2
Space-group number int_tables_number	95
Crystal system crystal_system	—

Resolution resolution	3.150 Å
Low-resolution limit resolution_low	29.230 Å
R factor r_factor	0.2360
R_work r_work	0.2360
R_free r_free	0.2940

Crystal Structure of AXH domain complexed with Capicua

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ataxin-1

State in the Current Structure

Other States of the Same Protein in the Database

Protein capicua homolog

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4j2l__assembly_1__model_1

4j2l__assembly_1__model_1 | I(q)

4j2l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (1)

Crystal Structure of AXH domain complexed with Capicua

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ataxin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein capicua homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4j2l__assembly_1__model_1

4j2l__assembly_1__model_1 | I(q)

4j2l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (1)