SAXSdb — 4jcv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Recombination protein RecR

Deinococcus radiodurans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	DNA repair protein RecO × 2 （Q9RW50） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RECR_DEIRA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 23–241； UniProt 2–220 Author chain B； PDBConstruct 23–241； UniProt 2–220 Author chain C； PDBConstruct 23–241； UniProt 2–220 Author chain D； PDBConstruct 23–241； UniProt 2–220

DNA repair protein RecO

Deinococcus radiodurans

UniProt Q9RW50

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Recombination protein RecR × 4 （Q9ZNA2） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9RW50_DEIRA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 23–265； UniProt 2–244 Author chain F； PDBConstruct 23–265； UniProt 2–244

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4jcv
Deposition date deposition_date	2013-02-22
Structure title title	Crystal structure of the RecOR complex in an open conformation
Keywords keywords	HOMOLOGOUS RECOMBINATION, RECFOR PATHWAY, DNA BINDING, ZINC-FINGER, DNA DAMAGE, DNA REPAIR, RECR, RECO, RECOR, RECOMBINATION; RECOMBINATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4jcv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4jcv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4jcv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.36 Å
Rg (electron density)	37.76 Å
Total Rg	38.31 Å
Atom count	9162
Residues	1206
Excluded volume	163790 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4jcv__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Recombination protein RecR
Molecular weight formula_weight	26143.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9162

MSYYHHHHHHLESTSLYKKAGLKYPPSLVSLIRELSRLPGIGPASAQALAFHLFEQPREDIERLASALLEAKRDLHVCPICFNITDAEKCDVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGRQTVSKPQPPQRPGDEDGADGAAVPASR

Source Source

Source organism organism	Deinococcus radiodurans
NCBI taxonomy ID ncbi_taxonomy_id	243230
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DNA repair protein RecO
Molecular weight formula_weight	28912.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MSYYHHHHHHLESTSLYKKAGLRSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS

Source Source

Source organism organism	Deinococcus radiodurans
NCBI taxonomy ID ncbi_taxonomy_id	243230
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	4jcvA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1360 — Dna Topoisomerase Vi A Subunit; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4jcvB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1360 — Dna Topoisomerase Vi A Subunit; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4jcvC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1360 — Dna Topoisomerase Vi A Subunit; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4jcvD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1360 — Dna Topoisomerase Vi A Subunit; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4jcvE01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	4jcvE02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	120 — Recombination protein O, C-terminal domain

Domain ID domain_id	4jcvE03
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	220 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	20 — Recombination protein O, zinc-binding domain

Domain ID domain_id	4jcvF01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	4jcvF02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	120 — Recombination protein O, C-terminal domain

Domain ID domain_id	4jcvF03
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	220 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	20 — Recombination protein O, zinc-binding domain

▶

Unit-cell length a length_a	63.130 Å
Unit-cell length b length_b	93.110 Å
Unit-cell length c length_c	92.350 Å
Unit-cell angle α angle_alpha	103.60 °
Unit-cell angle β angle_beta	110.42 °
Unit-cell angle γ angle_gamma	106.22 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.340 Å
Low-resolution limit resolution_low	83.070 Å
R factor r_factor	0.2420
R_work r_work	0.2402
R_free r_free	0.2781

Crystal structure of the RecOR complex in an open conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Recombination protein RecR

State in the Current Structure

Other States of the Same Protein in the Database

DNA repair protein RecO

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4jcv__assembly_1__model_1

4jcv__assembly_1__model_1 | I(q)

4jcv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)

Crystal structure of the RecOR complex in an open conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Recombination protein RecR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA repair protein RecO

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4jcv__assembly_1__model_1

4jcv__assembly_1__model_1 | I(q)

4jcv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)