SAXSdb — 4kat

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thymidylate synthase

Thermotoga maritima MSB8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	2'-DEOXYURIDINE-5'-MONOPHOSPHATE × 4 DIHYDROFLAVINE-ADENINE DINUCLEOTIDE × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THYX_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–232； UniProt 1–220 Author chain B； PDBConstruct 13–232； UniProt 1–220 Author chain C； PDBConstruct 13–232； UniProt 1–220 Author chain D； PDBConstruct 13–232； UniProt 1–220

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4kat
Deposition date deposition_date	2013-04-22
Structure title title	Crystal structure of FDTS from T. maritima mutant (R174K) with FAD and dUMP
Keywords keywords	thyX, FDTS, FAD, dUMP, Novel FDTS fold, Convertion of dUMP to dTMP using Tetrahydrofolate, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4kat__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4kat__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4kat__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.81 Å
Rg (electron density)	28.37 Å
Total Rg	29.16 Å
Atom count	7495
Residues	860
Excluded volume	133650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4kat__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Thymidylate synthase
Molecular weight formula_weight	27475.7 kDa
EC 编号 ec_number	2.1.1.148
Mutation mutation	R174K
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	7606

MGSDKIHHHHHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV

Source Source

Source organism organism	Thermotoga maritima MSB8
NCBI taxonomy ID ncbi_taxonomy_id	243274
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	2'-DEOXYURIDINE-5'-MONOPHOSPHATE
Molecular weight formula_weight	308.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	DIHYDROFLAVINE-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	787.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	103

▼

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d4kata1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.207 — Thymidylate synthase-complementing protein Thy1
Superfamily Superfamily superfamily	d.207.1 — Thymidylate synthase-complementing protein Thy1
Family Family family	d.207.1.1 — Thymidylate synthase-complementing protein Thy1

Domain ID domain_id	d4kata2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4katb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.207 — Thymidylate synthase-complementing protein Thy1
Superfamily Superfamily superfamily	d.207.1 — Thymidylate synthase-complementing protein Thy1
Family Family family	d.207.1.1 — Thymidylate synthase-complementing protein Thy1

Domain ID domain_id	d4katb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4katc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.207 — Thymidylate synthase-complementing protein Thy1
Superfamily Superfamily superfamily	d.207.1 — Thymidylate synthase-complementing protein Thy1
Family Family family	d.207.1.1 — Thymidylate synthase-complementing protein Thy1

Domain ID domain_id	d4katd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.207 — Thymidylate synthase-complementing protein Thy1
Superfamily Superfamily superfamily	d.207.1 — Thymidylate synthase-complementing protein Thy1
Family Family family	d.207.1.1 — Thymidylate synthase-complementing protein Thy1

Domain ID domain_id	d4katd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	4katA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	4katB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	4katC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	4katD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	170 —

▶

Unit-cell length a length_a	53.680 Å
Unit-cell length b length_b	115.740 Å
Unit-cell length c length_c	140.460 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.140 Å
Low-resolution limit resolution_low	38.580 Å
R factor r_factor	0.1851
R_work r_work	0.1826
R_free r_free	0.2326

Crystal structure of FDTS from T. maritima mutant (R174K) with FAD and dUMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thymidylate synthase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4kat__assembly_1__model_1

4kat__assembly_1__model_1 | I(q)

4kat__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of FDTS from T. maritima mutant (R174K) with FAD and dUMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thymidylate synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4kat__assembly_1__model_1

4kat__assembly_1__model_1 | I(q)

4kat__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

CATH v4.4 (4 domains)

7. Citations (1)