SAXSdb — 4u15

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

Rattus norvegicus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 1 HEXAETHYLENE GLYCOL × 3 D(-)-TARTARIC ACID × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 1 HEXAETHYLENE GLYCOL × 1 D(-)-TARTARIC ACID × 2 (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 2	Consistent with protein count
3	Insufficient information	Homooligomer	Protein 2	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 2 HEXAETHYLENE GLYCOL × 4 D(-)-TARTARIC ACID × 4 (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D9IEF7_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 222–322； UniProt 61–161 Author chain B； PDBConstruct 222–322； UniProt 61–161

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

Rattus norvegicus

UniProt P08483

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 1 HEXAETHYLENE GLYCOL × 3 D(-)-TARTARIC ACID × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 1 HEXAETHYLENE GLYCOL × 1 D(-)-TARTARIC ACID × 2 (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 2	Consistent with protein count
3	Insufficient information	Homooligomer	Protein 2	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane × 2 HEXAETHYLENE GLYCOL × 4 D(-)-TARTARIC ACID × 4 (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACM3_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–204； UniProt 57–259 Author chain A； PDBConstruct 323–404； UniProt 482–563 Author chain B； PDBConstruct 2–204； UniProt 57–259 Author chain B； PDBConstruct 323–404； UniProt 482–563

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4u15
Deposition date deposition_date	2014-07-15
Structure title title	M3-mT4L receptor bound to tiotropium
Keywords keywords	GPCR T4L Stabillized Crystallography, MEMBRANE PROTEIN, MEMBRANE PROTEIN-INHIBITOR complex; MEMBRANE PROTEIN/INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4u15__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4u15__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4u15__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.44 Å
Rg (electron density)	28.22 Å
Total Rg	28.76 Å
Atom count	3151
Residues	391
Excluded volume	56907 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4u15__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4u15__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4u15__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3
Molecular weight formula_weight	47858.0 kDa
EC 编号 ec_number	3.2.1.17
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6342

GDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKRKRRKHHHHHHHH

Source Source

Source organism organism	Rattus norvegicus
Common name common_name	Rat
NCBI taxonomy ID ncbi_taxonomy_id	10116
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 non-polymer

Description description	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane
Molecular weight formula_weight	392.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	HEXAETHYLENE GLYCOL
Molecular weight formula_weight	282.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	D(-)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	nat
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate
Molecular weight formula_weight	356.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

Unit-cell length a length_a	152.311 Å
Unit-cell length b length_b	184.563 Å
Unit-cell length c length_c	52.613 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.54 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	28.477 Å
R factor r_factor	0.2316
R_work r_work	0.2300
R_free r_free	0.2614

M3-mT4L receptor bound to tiotropium

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

State in the Current Structure

Other States of the Same Protein in the Database

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4u15__assembly_1__model_1

4u15__assembly_1__model_1 | I(q)

4u15__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

M3-mT4L receptor bound to tiotropium

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Muscarinic acetylcholine receptor M3,Lysozyme,Muscarinic acetylcholine receptor M3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4u15__assembly_1__model_1

4u15__assembly_1__model_1 | I(q)

4u15__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)