4u3f

Cytochrome bc1 complex from chicken with designed inhibitor bound

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX31_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–446； UniProt 1–446 Author chain N； PDBConstruct 1–446； UniProt 1–446

Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

OrganismNot specified

UniProt D0VX29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX29_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–441； UniProt 1–441 Author chain O； PDBConstruct 1–441； UniProt 1–441

Cytochrome b

OrganismNot specified

UniProt P18946

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_CHICK
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 2–380； UniProt 2–380 Author chain P； PDBConstruct 2–380； UniProt 2–380

Mitochondrial cytochrome c1, heme protein

OrganismNot specified

UniProt D0VX26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX26_CHICK
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 1–241 Author chain Q； PDBConstruct 1–241； UniProt 1–241

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt Q5ZLR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_CHICK
Isoform	—
PDB entities	5, 9
Chains and sequence ranges	Author chain E； PDBConstruct 1–196； UniProt 77–272 Author chain R； PDBConstruct 1–196； UniProt 77–272 Author chain I； PDBConstruct 2–76； UniProt 2–76 Author chain V； PDBConstruct 2–76； UniProt 2–76

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt D0VX30

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX30_CHICK
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 1–110 Author chain S； PDBConstruct 1–110； UniProt 1–110

Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

OrganismNot specified

UniProt D0VX32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX32_CHICK
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–81； UniProt 1–81 Author chain T； PDBConstruct 1–81； UniProt 1–81

Cytochrome b-c1 complex subunit 6

OrganismNot specified

UniProt D0VX28

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein × 2 （D0VX27） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX28_CHICK
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–77； UniProt 1–77 Author chain U； PDBConstruct 1–77； UniProt 1–77

Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

OrganismNot specified

UniProt D0VX27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i × 2 （D0VX31） Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2 × 2 （D0VX29） Cytochrome b × 2 （P18946） Mitochondrial cytochrome c1, heme protein × 2 （D0VX26） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） Cytochrome b-c1 complex subunit 7 × 2 （D0VX30） Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c × 2 （D0VX32） Cytochrome b-c1 complex subunit 6 × 2 （D0VX28） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q5ZLR5） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 PROTOPORPHYRIN IX CONTAINING FE × 4 methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate × 2 UBIQUINONE-10 × 2 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 2 HEME C × 2 CARDIOLIPIN × 4 octyl beta-D-glucopyranoside × 3 FE2/S2 (INORGANIC) CLUSTER × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D0VX27_CHICK
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–61； UniProt 1–61 Author chain W； PDBConstruct 1–61； UniProt 1–61

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4u3f
Deposition date deposition_date	2014-07-21
Structure title title	Cytochrome bc1 complex from chicken with designed inhibitor bound
Keywords keywords	;CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, UBIQUINONE, COMPLEX III, STROBILURINS, AZOXYSTROBIN, STIGMATELLIN, OXIDOREDUCTASE, REDOX ENZYME RESPIRATORY CHAIN, ELECTRON TRANSPORT, HEME, INNER MEMBRANE, MEMBRANE BINDING, MITOCHONDRION, TRANSMEMBRANE, IRON, MITOCHONDRIAL INNER MEMBRANE, RESPIRATORY CHAIN, 2FE-2S, IRON-SULFUR, METAL-BINDING, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex ;; OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4u3f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4u3f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4u3f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.33 Å
Rg (electron density)	54.33 Å
Total Rg	54.51 Å
Atom count	32759
Residues	4063
Excluded volume	585780 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4u3f__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i
Molecular weight formula_weight	49503.8 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	32790

AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF

Entity 2 Entity 2 polymer

Description description	Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2
Molecular weight formula_weight	46683.8 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTKGASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKATYWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVAQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42651.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY

Entity 4 Entity 4 polymer

Description description	Mitochondrial cytochrome c1, heme protein
Molecular weight formula_weight	26973.7 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21506.2 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13394.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERLEREAWNKK

Entity 7 Entity 7 polymer

Description description	Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c
Molecular weight formula_weight	9498.7 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6
Molecular weight formula_weight	9057.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	7721.1 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,V

MLSVAARSGPFAPYLSAAAHAVPGPLKAXXXXXXXXXXXXXXLKRPLLCRESMSGRSARRDLVAGISLNAPASVRY

Entity 10 Entity 10 polymer

Description description	Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein
Molecular weight formula_weight	7006.0 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,W

ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE

Entity 11 Entity 11 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 12 Entity 12 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	methyl (2E)-3-methoxy-2-(2-{[(5-methoxy-1,3-benzothiazol-2-yl)sulfanyl]methyl}phenyl)prop-2-enoate
Molecular weight formula_weight	401.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	UBIQUINONE-10
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	octyl beta-D-glucopyranoside
Molecular weight formula_weight	292.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 20 Entity 20 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	11

▼

6. Fold Classification (SCOP + CATH) 28 domains

CATH v4.4 (28 domains)

Domain ID domain_id	4u3fA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	4u3fD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4u3fD02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	4u3fE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	4u3fE02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	4u3fF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	4u3fG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	4u3fH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	4u3fI00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	4u3fJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	4u3fN01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fN02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fO01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fO02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	4u3fP00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	4u3fQ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4u3fQ02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	4u3fR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	4u3fR02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	4u3fS00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	4u3fT00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	4u3fU00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	4u3fV00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	4u3fW00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

▶

Unit-cell length a length_a	167.251 Å
Unit-cell length b length_b	181.483 Å
Unit-cell length c length_c	239.631 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.231 Å
Low-resolution limit resolution_low	14.996 Å
R factor r_factor	0.2374
R_work r_work	0.2364
R_free r_free	0.2836

Cytochrome bc1 complex from chicken with designed inhibitor bound

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial cytochrome c1, heme protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4u3f__assembly_1__model_1

4u3f__assembly_1__model_1 | I(q)

4u3f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment