SAXSdb — 4uus

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMEOTIC PROTEIN ULTRABITHORAX

DROSOPHILA MELANOGASTER

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 292–367	Fragment：HOMEODOMAIN AND UBDA, RESIDUES 292-367 Mutation：YES	HOMEOTIC PROTEIN EXTRADENTICLE × 1 （P40427） 5'-D(GPTPCPGPCPCPAPTPAPAPAPTPCPAPC)-3' × 1 5'-D(APCPGPTPGPAPTPTPTPAPTPGPGPCPG)-3' × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.5；0.2M AMONIUM SULFATE, 0.1 M TRI-SODIUM-CITRATE PH 4.5, 4% P4000	Resolution 2.55 Å R-free 0.239
2	Protein–DNA Heteromer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain E； UniProt 292–367	Fragment：HOMEODOMAIN AND UBDA, RESIDUES 292-367 Mutation：YES	HOMEOTIC PROTEIN EXTRADENTICLE × 1 （P40427） 5'-D(GPTPCPGPCPCPAPTPAPAPAPTPCPAPC)-3' × 1 5'-D(APCPGPTPGPAPTPTPTPAPTPGPGPCPG)-3' × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.5；0.2M AMONIUM SULFATE, 0.1 M TRI-SODIUM-CITRATE PH 4.5, 4% P4000	Resolution 2.55 Å R-free 0.239

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4UUS	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B8I STRUCTURE OF THE HOMEOTIC UBX/EXD/DNA TERNARY COMPLEX Deposited 1999-02-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 233–313（81 aa） Fragment：YPWM MOTIF AND HOMEODOMAIN	Mutation：C139S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；0.6M AMMONIUM PHOSPHATE, pH 4.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.304
4CYC CRYSTAL STRUCTURE OF A UBX-EXD-DNA COMPLEX INCLUDING THE HEXAPEPTIDE AND UBDA MOTIFS Deposited 2014-04-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 233–324（92 aa） Fragment：HOMEODOMAIN WITH HX AND UBDA, RESIDUES 233-367	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M AMMONIUM PHOSPHATE, pH 7.5	Resolution 2.36 Å R-free 0.227
4UUT Crystal structure of the Ultrabithorax protein Deposited 2014-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 233–324（92 aa） Fragment：HOMEODOMAIN AND UBDA, RESIDUES 233-324	Not recorded	SO4 SULFATE ION × 4 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 20% 1-4 BUTANEDIOL, 0.2M LISO4, 0.1M MES PH 6	Resolution 2.80 Å R-free 0.237
8F36 Ubx Homeodomain NMR solution structure Deposited 2022-11-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 295–354（60 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 128；Pressure 1 NMR sample composition 0.76 mM [U-100% 13C; U-100% 15N] UbxHD, 20 mM MES, 100 mM NaCl, 2 mM TCEP, 5 mM MgCl2, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9YZP Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence TGATGAGCAG and loaded with ultrabithorax homeodomain Deposited 2025-10-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain D 295–354（60 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；40mM Magnesium acetate, 1.5M Lithium sulfate, 50mM MES pH 6.5. The crystal was crosslinked with 45mg/mL EDC overnight, and then looped into a solution of 50mM potassium chloride, 4mM calcium chloride, 10% glycerol, and 10mM Tris hydrochloride for 1 hour. The drop was then supplemented with 40 micromolar Ultrabithorax homeodomain.	Resolution 3.67 Å R-free 0.295
9YZR Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence TAATTAGGCCG and loaded with ultrabithorax homeodomain Deposited 2025-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain D 295–354（60 aa） Chain E 295–354（60 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；30mM magnesium acetate, 900mM Lithium sulfate, 50mM MES pH 6.5. The crystal was crosslinked with 48mg/mL EDC overnight, and then looped into a solution of 35mM potassium chloride, 4mM calcium chloride, 10% glycerol, and 10mM Tris hydrochloride for 1 hour. The drop was then supplemented with 80 micromolar Ultrabithorax homeodomain.	Resolution 3.39 Å R-free 0.298

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	UBX_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–77； UniProt 292–367 Author chain E； PDBConstruct 2–77； UniProt 292–367

HOMEOTIC PROTEIN EXTRADENTICLE

DROSOPHILA MELANOGASTER

UniProt P40427

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain B； UniProt 238–312	Fragment：HOMEODOMAIN RESIDUES 238-312	HOMEOTIC PROTEIN ULTRABITHORAX × 1 （P83949） 5'-D(GPTPCPGPCPCPAPTPAPAPAPTPCPAPC)-3' × 1 5'-D(APCPGPTPGPAPTPTPTPAPTPGPGPCPG)-3' × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.5；0.2M AMONIUM SULFATE, 0.1 M TRI-SODIUM-CITRATE PH 4.5, 4% P4000	Resolution 2.55 Å R-free 0.239
2	Protein–DNA Heteromer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain F； UniProt 238–312	Fragment：HOMEODOMAIN RESIDUES 238-312	HOMEOTIC PROTEIN ULTRABITHORAX × 1 （P83949） 5'-D(GPTPCPGPCPCPAPTPAPAPAPTPCPAPC)-3' × 1 5'-D(APCPGPTPGPAPTPTPTPAPTPGPGPCPG)-3' × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.5；0.2M AMONIUM SULFATE, 0.1 M TRI-SODIUM-CITRATE PH 4.5, 4% P4000	Resolution 2.55 Å R-free 0.239

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4UUS	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B8I STRUCTURE OF THE HOMEOTIC UBX/EXD/DNA TERNARY COMPLEX Deposited 1999-02-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 238–300（63 aa） Fragment：HOMEODOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；0.6M AMMONIUM PHOSPHATE, pH 4.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.304
2R5Y Structure of Scr/Exd complex bound to a consensus Hox-Exd site Deposited 2007-09-04	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 238–300（63 aa） Fragment：Homeobox TALE-type DNA-binding domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.7；277 K；20% MPD, 10-14% PEG 4000, 0.2M sodium acetate, 0.2M potassium chloride, 0.1M Tris , pH 8.7, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.299
2R5Z Structure of Scr/Exd complex bound to a DNA sequence derived from the fkh gene Deposited 2007-09-04	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 238–300（63 aa） Fragment：Homeobox TALE-type DNA-binding domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.7；10-14 % PEG 4K, 20 % MPD, 0.1 M Tris, pH 8.7-8.9, 0.2 M Sodium Acetate, 0.2 M Potassium Chloride	Resolution 2.60 Å R-free 0.303
4CYC CRYSTAL STRUCTURE OF A UBX-EXD-DNA COMPLEX INCLUDING THE HEXAPEPTIDE AND UBDA MOTIFS Deposited 2014-04-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 238–312（75 aa） Fragment：HOMEODOMAIN RESIDUES 238-312	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M AMMONIUM PHOSPHATE, pH 7.5	Resolution 2.36 Å R-free 0.227
5ZJQ Structure of AbdB/Exd complex bound to a 'Red14' DNA sequence Deposited 2018-03-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 237–310（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；200mM MgCl2, 0.1M Tris pH 5.8, 17.5% PEG 4000, 5% glycerol	Resolution 2.44 Å R-free 0.252
5ZJR Structure of AbdB/Exd complex bound to a 'Magenta14' DNA sequence Deposited 2018-03-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 237–310（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；90mM MgCl2, 0.1M Tris pH9.0, 22% PEG 3350	Resolution 3.03 Å R-free 0.288
5ZJS Structure of AbdB/Exd complex bound to a 'Blue14' DNA sequence Deposited 2018-03-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 237–310（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；200mM MgCl2, 0.1M Tris pH 5.8, 17.5% PEG 3350, 2.5% glycerol	Resolution 2.90 Å R-free 0.281
5ZJT Structure of AbdB/Exd complex bound to a 'Black14' DNA sequence Deposited 2018-03-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 237–310（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1M Sodium citrate pH 5.3, 25% PEG 3350	Resolution 2.40 Å R-free 0.276
7YB4 Solution structure of homeodomain of EXTRADENTICLE Deposited 2022-06-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 238–300（63 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure 1 NMR sample composition 0.6 mM [U-13C; U-15N] Homeobox protein Extradenticle, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-13C; U-15N] Homeobox protein Extradenticle, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EXD_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–76； UniProt 238–312 Author chain F； PDBConstruct 2–76； UniProt 238–312

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uus
Deposition date deposition_date	2014-07-31
Structure title title	CRYSTAL STRUCTURE OF A UBX-EXD-DNA COMPLEX INCLUDING THE UBDA MOTIF
Keywords keywords	TRANSCRIPTION, HOMEODOMAIN, HOX PROTEIN, PBC PROTEIN, DNA PROTEIN COMPLEX, TRANSCRIPTION FACTOR; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.94 Å
Radius of gyration Rg (electron density) rg_electron	26.53 Å
Forward intensity I(0) i0	64944300.00
Molecular weight molecular_weight	50561.0 kDa
Excluded volume excluded_volume	58040 Å³
Envelope volume envelope_volume	81982 Å³
Hydration-shell volume shell_volume	26697 Å³
Envelope diameter envelope_diameter	95.0 Å
Shell Rg shell_rg	32.70 Å
Envelope Rg envelope_rg	26.23 Å
Shape Rg shape_rg	26.52 Å
Total Rg total_rg	27.16 Å
Total atoms total_atoms	3492
Residues n_residues	321
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	88.2 Å
Rg (real space) rg_real	26.96 Å
Rg uncertainty (real space) rg_real_error	0.82 Å
I(0) (real space) i0_real	6.4940e+07
I(0) uncertainty (real space) i0_real_error	9.6090e+05
Rg (reciprocal space) rg_reciprocal	26.96 Å
I(0) (reciprocal space) i0_reciprocal	64940000.0000
Solution quality estimate total_estimate	0.8194
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	86.7 Å
Skewness Skewness skewness	0.309
Kurtosis Kurtosis kurtosis	-0.480
Angular range angular_range	— – 0.2950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	7803000.0000
Real-space data points n_real_points	60
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.904; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.937; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	HOMEOTIC PROTEIN ULTRABITHORAX
Molecular weight formula_weight	9591.1 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	3652

GNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQA

来源 Source

来源生物 organism	DROSOPHILA MELANOGASTER
通用名 common_name	FRUIT FLY
NCBI Class编号 ncbi_taxonomy_id	7227
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	HOMEOTIC PROTEIN EXTRADENTICLE
Molecular weight formula_weight	8857.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

GARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAA

来源 Source

来源生物 organism	DROSOPHILA MELANOGASTER
通用名 common_name	FRUIT FLY
NCBI Class编号 ncbi_taxonomy_id	7227
宿主生物 host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	5'-D(GPTPCPGPCPCPAPTPAPAPAPTPCPAP*C)-3'
Molecular weight formula_weight	4538.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,G

GTCGCCATAAATCAC

Entity 4 Entity 4 polymer

Description description	5'-D(APCPGPTPGPAPTPTPTPAPTPGPGPCP*G)-3'
Molecular weight formula_weight	4640.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D,H

ACGTGATTTATGGCG

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	160

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4uusA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	4uusB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	4uusE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	4uusF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	42.670 Å
Unit-cell length b length_b	95.920 Å
Unit-cell length c length_c	69.820 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.34 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.550 Å
Low-resolution limit resolution_low	38.550 Å
R factor r_factor	0.1901
R_work r_work	0.1874
R_free r_free	0.2395

fit	/app/data/saxs_computation/uu/4uus/4uus.fit
pddf	/app/data/pr_computation/uu/4uus/4uus.pr.out
profile	/app/data/saxs_computation/uu/4uus/4uus.dat

CRYSTAL STRUCTURE OF A UBX-EXD-DNA COMPLEX INCLUDING THE UBDA MOTIF

1. Protein Identity and Related Structures Protein Identity & Related Structures

HOMEOTIC PROTEIN ULTRABITHORAX

State in the Current Structure

Other States of the Same Protein in the Database

HOMEOTIC PROTEIN EXTRADENTICLE

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)