SAXSdb — 4uy2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9

HOMO SAPIENS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	ALPHA-BUNGAROTOXIN ISOFORM V31 × 1 （P60616） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	ALPHA-BUNGAROTOXIN ISOFORM V31 × 1 （P60616） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACHA9_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–212； UniProt 26–237 Author chain B； PDBConstruct 1–212； UniProt 26–237

ALPHA-BUNGAROTOXIN ISOFORM V31

OrganismNot specified

UniProt P60616

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9 × 1 （Q9UGM1） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9 × 1 （Q9UGM1） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NXL1V_BUNMU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–74； UniProt 22–95 Author chain D； PDBConstruct 1–74； UniProt 22–95

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uy2
Deposition date deposition_date	2014-08-28
Structure title title	Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.
Keywords keywords	TOXIN-BINDING PROTEIN-TOXIN COMPLEX, LIGAND BINDING DOMAIN, CYS-LOOP RECEPTOR; TOXIN-BINDING PROTEIN/TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4uy2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4uy2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4uy2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.23 Å
Rg (electron density)	22.29 Å
Total Rg	23.14 Å
Atom count	2234
Residues	276
Excluded volume	39606 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4uy2__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4uy2__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
Molecular weight formula_weight	25307.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4468

ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSHHHHHH

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	KOMAGATAELLA PASTORIS

Entity 2 Entity 2 polymer

Description description	ALPHA-BUNGAROTOXIN ISOFORM V31
Molecular weight formula_weight	8033.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4uy2a_
Class class	b — All beta proteins
Fold Fold fold	b.96 — Nicotinic receptor ligand binding domain-like
Superfamily Superfamily superfamily	b.96.1 — Nicotinic receptor ligand binding domain-like
Family Family family	b.96.1.0 — automated matches

Domain ID domain_id	d4uy2b_
Class class	b — All beta proteins
Fold Fold fold	b.96 — Nicotinic receptor ligand binding domain-like
Superfamily Superfamily superfamily	b.96.1 — Nicotinic receptor ligand binding domain-like
Family Family family	b.96.1.0 — automated matches

Domain ID domain_id	d4uy2c_
Class class	g — Small proteins
Fold Fold fold	g.7 — Snake toxin-like
Superfamily Superfamily superfamily	g.7.1 — Snake toxin-like
Family Family family	g.7.1.1 — Snake venom toxins

Domain ID domain_id	d4uy2d_
Class class	g — Small proteins
Fold Fold fold	g.7 — Snake toxin-like
Superfamily Superfamily superfamily	g.7.1 — Snake toxin-like
Family Family family	g.7.1.1 — Snake venom toxins

CATH v4.4 (4 domains)

Domain ID domain_id	4uy2A00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	4uy2B00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	4uy2C00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4uy2D00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

▶

Unit-cell length a length_a	42.319 Å
Unit-cell length b length_b	119.348 Å
Unit-cell length c length_c	79.107 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.02 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.697 Å
Low-resolution limit resolution_low	47.185 Å
R factor r_factor	0.2617
R_work r_work	0.2581
R_free r_free	0.3312

Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9

State in the Current Structure

Other States of the Same Protein in the Database

ALPHA-BUNGAROTOXIN ISOFORM V31

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uy2__assembly_1__model_1

4uy2__assembly_1__model_1 | I(q)

4uy2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ALPHA-BUNGAROTOXIN ISOFORM V31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uy2__assembly_1__model_1

4uy2__assembly_1__model_1 | I(q)

4uy2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)