4v4n

Structure of the Methanococcus jannaschii ribosome-SecYEBeta channel complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Preprotein translocase subunit SecE

Methanococcus jannaschii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 4	Preprotein translocase subunit SecG × 1 （P60460） 50S ribosomal protein L39E × 1 50S ribosomal protein L19E × 1 50S ribosomal protein L22P × 1 50S ribosomal protein L23P × 1 50S ribosomal protein L24P × 1 50S ribosomal protein L29P × 1 Protein translocase subunit SecY × 1 （Q60175） E-tRNA × 1 16S ribosomal RNA × 1 30S ribosomal protein L7AE × 2 30S ribosomal protein S3AE × 1 30S ribosomal protein S2P × 1 30S ribosomal protein S3P × 1 30S ribosomal protein S4P × 1 30S ribosomal protein S4E × 1 30S ribosomal protein S5P × 1 30S ribosomal protein S6E × 1 30S ribosomal protein S7P × 1 30S ribosomal protein S8P × 1 30S ribosomal protein S8E × 1 30S ribosomal protein S9P × 1 30S ribosomal protein S10P × 1 30S ribosomal protein S11P × 1 30S ribosomal protein S12P × 1 30S ribosomal protein S13P × 1 30S ribosomal protein S14P × 1 30S ribosomal protein S15P/S13E × 1 30S ribosomal protein S17P × 1 30S ribosomal protein S17E × 1 30S ribosomal protein S19P × 1 30S ribosomal protein S19E × 1 30S ribosomal protein S24E × 1 30S ribosomal protein S27E × 1 30S ribosomal protein S28E × 1 30S ribosomal protein S27AE × 1 23S ribosomal RNA × 1 5S ribosomal RNA × 1 50S ribosomal protein L14E × 2 50S ribosomal protein L1P × 1 50S ribosomal protein L31E × 1 50S ribosomal protein L2 × 1 50S ribosomal protein L32E × 1 50S ribosomal protein L3P × 1 50S ribosomal protein L4P × 1 50S ribosomal protein L34E × 1 50S ribosomal protein L5P × 1 50S ribosomal protein L37E × 1 50S ribosomal protein L6P × 1 50S ribosomal protein L40E × 1 50S ribosomal protein L11P × 1 50S ribosomal protein L41E × 1 50S ribosomal protein L13P × 1 50S ribosomal protein L37AE × 1 50S ribosomal protein L14P × 1 50S ribosomal protein L44E × 1 50S ribosomal protein P0/L10E × 1 50S ribosomal protein L15P × 1 50S ribosomal protein L15E × 1 50S ribosomal protein L10E/L16 × 1 50S ribosomal protein L18P × 1 50S ribosomal protein L18E × 1 50S ribosomal protein L21E × 1 50S ribosomal protein L24E × 1 50S ribosomal protein L30P × 1 50S ribosomal protein L30E × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECE_METJA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A7； PDBConstruct 1–67； UniProt 1–67

Preprotein translocase subunit SecG

Methanococcus jannaschii

UniProt P60460

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 4	Preprotein translocase subunit SecE × 1 （Q57817） 50S ribosomal protein L39E × 1 50S ribosomal protein L19E × 1 50S ribosomal protein L22P × 1 50S ribosomal protein L23P × 1 50S ribosomal protein L24P × 1 50S ribosomal protein L29P × 1 Protein translocase subunit SecY × 1 （Q60175） E-tRNA × 1 16S ribosomal RNA × 1 30S ribosomal protein L7AE × 2 30S ribosomal protein S3AE × 1 30S ribosomal protein S2P × 1 30S ribosomal protein S3P × 1 30S ribosomal protein S4P × 1 30S ribosomal protein S4E × 1 30S ribosomal protein S5P × 1 30S ribosomal protein S6E × 1 30S ribosomal protein S7P × 1 30S ribosomal protein S8P × 1 30S ribosomal protein S8E × 1 30S ribosomal protein S9P × 1 30S ribosomal protein S10P × 1 30S ribosomal protein S11P × 1 30S ribosomal protein S12P × 1 30S ribosomal protein S13P × 1 30S ribosomal protein S14P × 1 30S ribosomal protein S15P/S13E × 1 30S ribosomal protein S17P × 1 30S ribosomal protein S17E × 1 30S ribosomal protein S19P × 1 30S ribosomal protein S19E × 1 30S ribosomal protein S24E × 1 30S ribosomal protein S27E × 1 30S ribosomal protein S28E × 1 30S ribosomal protein S27AE × 1 23S ribosomal RNA × 1 5S ribosomal RNA × 1 50S ribosomal protein L14E × 2 50S ribosomal protein L1P × 1 50S ribosomal protein L31E × 1 50S ribosomal protein L2 × 1 50S ribosomal protein L32E × 1 50S ribosomal protein L3P × 1 50S ribosomal protein L4P × 1 50S ribosomal protein L34E × 1 50S ribosomal protein L5P × 1 50S ribosomal protein L37E × 1 50S ribosomal protein L6P × 1 50S ribosomal protein L40E × 1 50S ribosomal protein L11P × 1 50S ribosomal protein L41E × 1 50S ribosomal protein L13P × 1 50S ribosomal protein L37AE × 1 50S ribosomal protein L14P × 1 50S ribosomal protein L44E × 1 50S ribosomal protein P0/L10E × 1 50S ribosomal protein L15P × 1 50S ribosomal protein L15E × 1 50S ribosomal protein L10E/L16 × 1 50S ribosomal protein L18P × 1 50S ribosomal protein L18E × 1 50S ribosomal protein L21E × 1 50S ribosomal protein L24E × 1 50S ribosomal protein L30P × 1 50S ribosomal protein L30E × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECG_METJA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A8； PDBConstruct 1–52； UniProt 1–52

Protein translocase subunit SecY

Methanococcus jannaschii

UniProt Q60175

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 4	Preprotein translocase subunit SecE × 1 （Q57817） Preprotein translocase subunit SecG × 1 （P60460） 50S ribosomal protein L39E × 1 50S ribosomal protein L19E × 1 50S ribosomal protein L22P × 1 50S ribosomal protein L23P × 1 50S ribosomal protein L24P × 1 50S ribosomal protein L29P × 1 E-tRNA × 1 16S ribosomal RNA × 1 30S ribosomal protein L7AE × 2 30S ribosomal protein S3AE × 1 30S ribosomal protein S2P × 1 30S ribosomal protein S3P × 1 30S ribosomal protein S4P × 1 30S ribosomal protein S4E × 1 30S ribosomal protein S5P × 1 30S ribosomal protein S6E × 1 30S ribosomal protein S7P × 1 30S ribosomal protein S8P × 1 30S ribosomal protein S8E × 1 30S ribosomal protein S9P × 1 30S ribosomal protein S10P × 1 30S ribosomal protein S11P × 1 30S ribosomal protein S12P × 1 30S ribosomal protein S13P × 1 30S ribosomal protein S14P × 1 30S ribosomal protein S15P/S13E × 1 30S ribosomal protein S17P × 1 30S ribosomal protein S17E × 1 30S ribosomal protein S19P × 1 30S ribosomal protein S19E × 1 30S ribosomal protein S24E × 1 30S ribosomal protein S27E × 1 30S ribosomal protein S28E × 1 30S ribosomal protein S27AE × 1 23S ribosomal RNA × 1 5S ribosomal RNA × 1 50S ribosomal protein L14E × 2 50S ribosomal protein L1P × 1 50S ribosomal protein L31E × 1 50S ribosomal protein L2 × 1 50S ribosomal protein L32E × 1 50S ribosomal protein L3P × 1 50S ribosomal protein L4P × 1 50S ribosomal protein L34E × 1 50S ribosomal protein L5P × 1 50S ribosomal protein L37E × 1 50S ribosomal protein L6P × 1 50S ribosomal protein L40E × 1 50S ribosomal protein L11P × 1 50S ribosomal protein L41E × 1 50S ribosomal protein L13P × 1 50S ribosomal protein L37AE × 1 50S ribosomal protein L14P × 1 50S ribosomal protein L44E × 1 50S ribosomal protein P0/L10E × 1 50S ribosomal protein L15P × 1 50S ribosomal protein L15E × 1 50S ribosomal protein L10E/L16 × 1 50S ribosomal protein L18P × 1 50S ribosomal protein L18E × 1 50S ribosomal protein L21E × 1 50S ribosomal protein L24E × 1 50S ribosomal protein L30P × 1 50S ribosomal protein L30E × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECY_METJA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AX； PDBConstruct 1–436； UniProt 1–436

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v4n
Deposition date deposition_date	2013-06-17
Structure title title	Structure of the Methanococcus jannaschii ribosome-SecYEBeta channel complex
Keywords keywords	;archaea, archaeal, ribosomal, 50S, protein synthesis, RNA, large subunit, co-translational translocation, protein conducting channel, RIBOSOME-PROTEIN TRANSPORT complex ;; RIBOSOME/PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v4n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v4n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v4n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.54 Å
Rg (electron density)	89.66 Å
Total Rg	89.48 Å
Atom count	171094
Residues	13509
Excluded volume	2690700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v4n__assembly_1__model_1`	69-meric （69）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (67)

Entity 1 Entity 1 polymer

Description description	Preprotein translocase subunit SecE
Molecular weight formula_weight	7701.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A7
Atom count atom_count	171094

MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK

Source Source

Source organism organism	Methanococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Preprotein translocase subunit SecG
Molecular weight formula_weight	5853.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A8

MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRF

Source Source

Source organism organism	Methanococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	50S ribosomal protein L39E
Molecular weight formula_weight	6323.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af

MARNKPLAKKLRLAKALKQNRRVPVWVIVKTNRRVLTHPKRRYWRRTKLKE

Entity 4 Entity 4 polymer

Description description	50S ribosomal protein L19E
Molecular weight formula_weight	17920.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MNTLKMQRRIAAEILKCGENRIWIDPERIDDVASAITREDIKRLIKEGVIKKKPIKGQSRYRAKIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIRALRKELRKLKAQKKIDRKTYRMLYIRAKGGQFKNKHQLYLFLEEHGLLKK

Entity 5 Entity 5 polymer

Description description	50S ribosomal protein L22P
Molecular weight formula_weight	17044.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS

GYSFQNFDPKRMARASARDLRISPKLAVEVCRELRGMMLNDALRYLDDVIALKRPVPLKRYNDSQGHKPGKGFGPGRYPVKVAKAIKKVLLNVKNNAVQKGLDPDKLKIIHIAAHKGPVLRGWYPRAFGRATPFNEQTTHIEVVVEEIRR

Entity 6 Entity 6 polymer

Description description	50S ribosomal protein L23P
Molecular weight formula_weight	9647.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT

PYKVIIRPVVTEKAISLIEKENKLTFIVDRRATKQDIKRAVEEIFNVKVEKVNTLITPRGEKKAYVKLKPEYSASEVAARLGLF

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L24P
Molecular weight formula_weight	14365.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MKISSKQPRKQRKFLYNAPLHVRQKLMSAPLSRELREKYKVRNLPVRVGDKVRIMRGDYKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNVMIIELNLEDEKRKKIIERRAG

Entity 8 Entity 8 polymer

Description description	50S ribosomal protein L29P
Molecular weight formula_weight	8549.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW

MKPSEIREMSIEEIDAKIRELRLQLAKERGLLTMGTSLENPMVIRNLRRDIARLLTIKKEKLREREKGKVKK

Entity 9 Entity 9 polymer

Description description	Protein translocase subunit SecY
Molecular weight formula_weight	47482.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX

MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK

Source Source

Source organism organism	Methanococcus jannaschii
NCBI taxonomy ID ncbi_taxonomy_id	2190
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	E-tRNA
Molecular weight formula_weight	24880.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B1

GGGGCGGUAGCUCAGCCUGGGAGAGCACCGGACUGAAGAUCCGGGUGUCGGGGGUUCAAAUCCCCCCCGCCCCACCA

Entity 11 Entity 11 polymer

Description description	16S ribosomal RNA
Molecular weight formula_weight	485455.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B2

AUUCCGGUUGAUCCUGCCGGAGGCCACUGCUAUGGGGGUCCGACUAAGCCAUGCGAGUCAAGGGGGCGUCCCUUCUGGGACGCCACCGGCGGACGGCUCAGUAACACGUCGGUAACCUACCCUCGGGAGGGGGAUAACCCCGGGAAACUGGGGCUAAUCCCCCAUAGGCCUGGGGUACUGGAAGGUCCCCAGGCCGAAAGGGAGCCGUAAGGCCCGCCCGAGGAUGCGGCGGCGGCCGAUUAGGUAGUUGGUGGGGUAACGGCCCACCAAGCCGAAGAUCGGUACGGGCCGUGAGAGCGGGAGCCCGGAGAUGGACACUGAGACACGGGUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAACCUCCGCAAUGCGGGAAACCGCGACGGGGGGACCCCCAGUGCCGUGCCUCUGGCACGGCUUUUCCGGAGUGUAAAAAGCUCCGGGAAUAAGGGCUGGGCAAGGCCGGUGGCAGCCGCCGCGGUAAUACCGGCGGCCCGAGUGGUGGCCACUAUUAUUGGGCCUAAAGCGGCCGUAGCCGGGCCCGUAAGUCCCUGGCGAAAUCCCACGGCUCAACCGUGGGGCUCGCUGGGGAUACUGCGGGCCUUGGGACCGGGAGAGGCCGGGGGUACCCCCGGGGUAGGGGUGAAAUCCUAUAAUCCCGGGGGGACCGCCAGUGGCGAAGGCGCCCGGCUGGAACGGGUCCGACGGUGAGCGCGGAAGGCCAGGGGAGCGAACCGGAUUAGAUACCCGGGUAGUCCUGGCUGUAAAGGAUGCGGGCUAGGUGUCGGGCGAGCUUCGAGCUCGCCCGGUGCCGUAGGGAAGCCGUUAAGCCCGCCGCCUGGGGAGUACGGCCGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACCGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCCGUCAGCUCGUACCGUGAGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCCGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCCGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCCGAAACCCCCGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGACCCGACCUCGAAAGGGGAAGGGAAUCCCCUAAACCCGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCCGCGUGAAGCUGGAAUCCCUAGUACCCGCGUGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCACUCCACCCGAGCGGAGUCCGGGUGAGGCCUGAUCUCCUUCGGGAGGUCAGGUCGAGCCCGGGCUCCGUGAGGGGGGAGAAGUCGUAACAAGGUAACCGUAGGGGAACCUACGGCUCGAUCACCUCCU

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein L7AE
Molecular weight formula_weight	13414.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3,AG

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK

Entity 13 Entity 13 polymer

Description description	30S ribosomal protein S3AE
Molecular weight formula_weight	22151.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA

TRDKWKLKQWYIIYAPDFFGGVEVGLTPADDPEKVLNRVVEVTLKDVTGDFTKSHVKLYFQVYDVKGQNAYTKFKGMKLARSYIRSLVRRKTTRIDGIFNITTKDGYKLRVMAMAIAMRRIQTSQERAIRKIMQEIIYKKAEELNFKDFVLESVNGKIAAEIAKEAKKIYPLRKAEIRKIKVLEEPQVIA

Entity 14 Entity 14 polymer

Description description	30S ribosomal protein S2P
Molecular weight formula_weight	23039.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BB

MADEYLVPLDQYLAAGVHIGTQQKTKDMKKFIYRVRQDGLYVLDVRKTDERLKVAGKFLAKFEPQSILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKNFFEPDVLIVTDPRADHQAMREAVEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGEIQSREDFKIPVEEFEMKIVRR

Entity 15 Entity 15 polymer

Description description	30S ribosomal protein S3P
Molecular weight formula_weight	20742.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MAIERYFIREAVREMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILEKQFGLENPQIEVEEIKNPYLNAKVQAVRLAQALERGIHFRRAAYAALRAIMNNGARGVEIRLSGKLTGERAKSIRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPG

Entity 16 Entity 16 polymer

Description description	30S ribosomal protein S4P
Molecular weight formula_weight	20409.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

KKYETPPHPWIKERLDRERVLMDKYELKNKKELWKHETQLKNFRRRARRLLAARGKQAEIEREQLLARLKRLGLLPEDAVLDDVLSLTIEDILERRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANPQHPERMMIEKAKQGGEA

Entity 17 Entity 17 polymer

Description description	30S ribosomal protein S4E
Molecular weight formula_weight	27994.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

RKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRVLPNRIGKLILHPISEDEAFIKPLRIRNKRMIKGARVQLNFHDGTNHIVSIAEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEIKRFPMGWPDVVTIEDEEGELFDTLKEYAFVVGTDKPKISLP

Entity 18 Entity 18 polymer

Description description	30S ribosomal protein S5P
Molecular weight formula_weight	24453.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MSQEWKEYAKRVLDEWEPKTKLGMMVKEGQITDIHEIFRRGYQIKEPEIIDVLLPEVNARENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGKEVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFAVEGKEGSVRVRLIPGPRGLGLVIGDVGKKILRLAGVQDVWSQTFGETRTTVNFAKAVFNALYNTNRVAISPEM

Entity 19 Entity 19 polymer

Description description	30S ribosomal protein S6E
Molecular weight formula_weight	14002.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG

MATFKLVISDPKSGIAKQVEITGAETEKLIGKRIGDQIPAKELNINLNELFGKEFPEDVKLEIRGGTDKDGFPMRPDIHGPRRVRVLLSKGPGFRPKEKGERRKKTVRGNTISPEIVQVNVKLVY

Entity 20 Entity 20 polymer

Description description	30S ribosomal protein S7P
Molecular weight formula_weight	24701.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH

MAKPLNERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEQRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRNKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 21 Entity 21 polymer

Description description	30S ribosomal protein S8P
Molecular weight formula_weight	14553.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

TLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGRINKAGAIKPRFPVKVSEFEKWEKRFLPAFEFGILIVSTSQGVMSHKEAIEKGIGGRLIAYVY

Entity 22 Entity 22 polymer

Description description	30S ribosomal protein S8E
Molecular weight formula_weight	14293.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYGGNRKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAIIETEIGKAKVTSRPGQDGVVNAILLEE

Entity 23 Entity 23 polymer

Description description	30S ribosomal protein S9P
Molecular weight formula_weight	15317.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDIDVKVEGGGFMGQAEAARMAIARALVEWTGDMSLKEKFMKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 24 Entity 24 polymer

Description description	30S ribosomal protein S10P
Molecular weight formula_weight	11769.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL

MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 25 Entity 25 polymer

Description description	30S ribosomal protein S11P
Molecular weight formula_weight	14280.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

QVNIKKKEKWGIAHIYSSFNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Entity 26 Entity 26 polymer

Description description	30S ribosomal protein S12P
Molecular weight formula_weight	16249.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

GKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

Entity 27 Entity 27 polymer

Description description	30S ribosomal protein S13P
Molecular weight formula_weight	16948.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MANFRHIVRVAGVDLDGNKQLRWALTAIKGIGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 28 Entity 28 polymer

Description description	30S ribosomal protein S14P
Molecular weight formula_weight	6634.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIQGLMLCRHCFREVAPKLGFRKYE

Entity 29 Entity 29 polymer

Description description	30S ribosomal protein S15P/S13E
Molecular weight formula_weight	18640.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MARMHARKRGKSGSKRPPRTAPPIWVEYTVEEIENLVVKLRKEGYSTAMIGTILRDQYGIPSVKLFKDPDNPNRNLTITRILEKHGLAPEIPEDLMFLIRRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPKNWRYDPETAKLLVR

Entity 30 Entity 30 polymer

Description description	30S ribosomal protein S17P
Molecular weight formula_weight	13296.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MMRDIGLRVQPPAEKCDDPKCPWHGNLKIHGRVFEGIVVSDKPRKTVTVERQYYFYLNKYERYELRRSKIHAHNPPCINAKVGDKVLIAETRPLSKTKHFVVVAVLERAEERR

Entity 31 Entity 31 polymer

Description description	30S ribosomal protein S17E
Molecular weight formula_weight	7942.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRIAGYVTKLVRMKMEGKIL

Entity 32 Entity 32 polymer

Description description	30S ribosomal protein S19P
Molecular weight formula_weight	13177.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

FRYRGYTLEQLMNMSLEELARLFPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYKKPIRTHCRDMIILPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKKVEHG

Entity 33 Entity 33 polymer

Description description	30S ribosomal protein S19E
Molecular weight formula_weight	16633.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPEKFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEII

Entity 34 Entity 34 polymer

Description description	30S ribosomal protein S24E
Molecular weight formula_weight	11698.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MEIRIKEIKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYISKGYAKAYDSKERMLYIEPEYILIRDGLIEKKEGE

Entity 35 Entity 35 polymer

Description description	30S ribosomal protein S27E
Molecular weight formula_weight	6888.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MAKPIIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLICGATLVEPTGGKGIVKAKILEVLE

Entity 36 Entity 36 polymer

Description description	30S ribosomal protein S28E
Molecular weight formula_weight	8116.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRIGDILILRETEREAREIKSRR

Entity 37 Entity 37 polymer

Description description	30S ribosomal protein S27AE
Molecular weight formula_weight	5865.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MGQKWKLYEIKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK

Entity 38 Entity 38 polymer

Description description	23S ribosomal RNA
Molecular weight formula_weight	990820.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A1

GGGCUAGGACGCUAAGCCGCCCGGUGGAUGGCUCGGCUCGGGGCGCCGACGAAGGGCGUGGCAAGCUGCGAUAAGCCCCGGCGAGGCGCAGGCAGCCGUCGAACCGGGGAUUCCCGAAUGGGACCUCCCGCGGCUUAUGCCGCACUCCGGGGUUUAUCCCCGGAGGGGGAACGCGGGGAAUUGAAACAUCUUAGUACCCGCAGGAAAAGAAAGCAAAAGCGAUGCCGUGAGUAGGGGCGACCGAAAACGGCAGAGGGCAAACUGAACCCCGGGCCGACGAGGUUCGGGGGAUGUGGGGUUGUAGGGCCCCCGUAUGAGACCCUCGCGGGUGAAGCCGAAGUCCGCUGGAACGCGGCGCCGGAGAGGGUGAUAGCCCCGUAGGCGUAAGCCCGCAGGGUCUCGGGGGACCCUGAGUACCGUCGGUUGGAUAUCCGGCGGGAAGCUGGGAGGCAUCGGCUCCCAACCCUAAAUACGUCCCGAGACCGAUAGCGAACUAGUACCGUGAGGGAAAGCUGAAAAGCACCCCGGGAGGGGGGUGAAAAGAGCCUGAAACCGGGCGGCGAUAGGAGGGUGCGGCCCGAAAGGAAUGAGCCUCCCCGAAGGAAACCGCGGCGACGCGGGAGUACGAGGGGAGGGGACCGGGGUUGCACCGUCCGUCUUGAAACACGGGGCAGGGAGUUCGCGGCCGUGGCGAGGUUAAGGGGGUUAAGCCCCGUAGCCGCAGGGAAACCGACAUGCCCGCAGCCGGGCUUAUGCCCGGUGAGGGGCGGGGUGCGAAAGCGCCCGGAGUCACGGCCGCGAGACCCGAAACCGGUCGAUCUAGCCCGGGGCAGGGUGAAGUCCCUCAACCGAGGGAUGGAGGCCCGCUAGGGGUGCUGAUGUGCAGUUCGCUCCCGUGACCCCGGGCUAGGGGUGAAAGGCCAAUCGAGGCCGGAGAUAGCUGGUUCCCGCCGAAUCAUCCCGCAGGAUGGCCUCCCCGGAGGUAGGCGGUGGGGUAGAGCACUGAUUGGAGGUGCAGGGGGCGAAAGCCCCCGGCCUCCUGUCAAACUCCGAACCCACCGCCGCCGUAGAUGGGGGGAGUAGGGUGGCGGUGUAAGCCGUCCACCGAGAGGGGAACAACCCAGACCGGGGUUAAGGCCCCAAAGUGCCGGCUAAGUGUUACUCCAAAGGGUGUCCCGGGCCUUAGACAGCGGGGAGGUAGGCUUAGAAGCAGCCAUCCUUUAAAGAGUGCGUAACAGCUCACCCGUCGAGGUCCGGGGCCCCGAAAAUGGACGGGGCUCAAGCCGGCCGCCGAGACCCCGGCGCACGGACCGAUUGGUCCGUGAUCGGGUAGGCGGGCGUGCCGGUGGCGUAGAAGCCGGGCCGUAAGGUCCGGUGGAGCCGCCGGUAUCGCGGAUCCUGCCGGGAGUAGCAGCGUAGUCGGGUGAGAAUCCCGACCGCCGGAGGGGCCAGGGUUCCACGGCAAUGGUCGUCAGCCGUGGGUUAGUCGGUCCUAACCCCGCCCGUAACUCGGCGCGGGGGAAAGGGAAACGGGUUUAUAUUCCCGUACCGCGGGGGUAGGUGCGGCAACGCAAGCCCGGAGGGUGACGCCUCGGGGUAGGCGGACCGGCCGAUGAGGCCGGCUAAGCGUAUAAGCCCGGGGAGUGCCGUAAUGGCGAGAACCGGGUGAAAGCGCGAAUGGCCCCCCCGUUAGGGGGGUUCCGCCGAUCCCUGGGGCCCGUGAAAAGCCCUCCGGGAAUUCCGAUCCCCCGCGACCGUACCGAGAACCGACACAGGUGCCCCUGGGUGAGAAGCCUAAGGCGUGUCGGGGGAAACCCGGCCGAGGGAACUCGGCAAACUGGCCCCGUAACUUCGGGAGAAGGGGUGCCUGCGGGUGCGUAACCCGCAGGUCGCAGUGACUAGGGGGGCCCGACUGUUUAAUAAAAACACAGGUCCCAGCUAGCCCGAAAGGGUUUGUACUGGGGCCGACGCCUGCCCAGUGCCGGUAUGUGAAGCCCGGGUACAACCGGGUGAAGCACCGGUAAACGGCGGGGGUAACUAUAACCCUCUUAAGGUAGCGAAAUUCCUUGUCGGUUAAAUGCCGACCUGCAUGAAUGGCGUAACGAGGUCCCCGCUGUCCCCGGCCGGGGCCCGGCGAAACCUCUGCCUGGCGCGCAUGCCAGGGACCCCCGGUGGGAAGCGAAGACCCCAUGGAGCUUUACUGCAGCCUGCCGUUGCCACACGGCGGGGGGUGCGCAGCGUAGGCGGGAGGCGUCGAAGCCCGGCCUCCGGGUCGGGUGGAGCCGUCCAUGAGACACCGCCCACUCCCCGCUGUGUGGCUAACCCCCGAAAGGGGGGACAGCGGUAGGUGGGCAGUUUGGCUGGGGCGGCACGCCUCCGAAAAGGUAUCGGAGGCGCCCUAAGGUCGGCUCAGGCGGGUCAGGAAUCCGCCGUAGAGUGCAAGGGCAAAAGCCGGCCUGACUGGACCCGUAACAGAGGCGGGUCCAGCCCCGAAAGGGUGGCCUAGCGAACCCCUGUGCCUCCCCGGUGGGGGCCAGGGAUGACAGAAAAGCUACCCUGGGGAUAACAGAGUCGUCUCGGGCGAGAGCCCAUAUCGACCCCGAGGCUUGCUACCUCGCUGUCGGCUCUUCCCAUCCUGGCCCUGCAGCAGGGGCCAAGGGUGGGGGUGUUCACCCAUUAAAGGGGAACGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGAUGCUAUCUACCGGGGGUGUUGGCCGCCUGAGGGGAAGGUGCCCCUAGUACGAGAGGAACAGGGUGCCGCGGCCUCUGGUCUACCGGUUGUCCUCCCGGGCAUCGCCGGGCAGCUACGCCGCAGCCGAUAAGGCCUGAAAGCAUCUAAGGCCGAAGCGGCCCCCGAAAAUAGGCGGCCGUUCCCUGGCGCUUGGGCCUGGGCGACCGGCCCAUUGCCAGGGACGAGGGCUCGGGUAGAAGACCCGGUUGAUAGGGCGGGGAUGUAAGCGGGAAGGGUCAACCGACCCGCUUAGUCCGCCGCCCCUAAUCGCCCGAGGUCCUGCCCC

Entity 39 Entity 39 polymer

Description description	5S ribosomal RNA
Molecular weight formula_weight	40689.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A3

CGGCGGCCAUAGCGGGGGGGCCACACCCGGUCUCAUUUCGAACCCGGAAGUUAAGCCCCCCAGCGAUCCCGGUUGUACUGCCCUCCGAGAGGGGGCGGGAAGCCGGGGACGCCGCCGGCCACUAUC

Entity 40 Entity 40 polymer

Description description	50S ribosomal protein L14E
Molecular weight formula_weight	8751.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5,AK

AIDVGRIAVVIAGRRAGQKVVVVDIIDKNFVLVTGAGLNKVKRRRMNIKHIEPLPQKIDIPRGASDEEVRAALEKAGISLA

Entity 41 Entity 41 polymer

Description description	50S ribosomal protein L1P
Molecular weight formula_weight	23893.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA

MPFDRQKIVKAVKEAKARAKPRNFTQSVEVAVNLKDIDLKRPENRFKLEVVLPHGRGKDVKIAVIADGAVAEAARKLGLDVISSAELEEIASSPRQARKLAKKYDFFIAEAPLMPKIGRYLGRYLGPRNKMPVVVPPTLTDLTPIVEKLKKTVRIQLKNNPVVHAPVGTEKMSDEEIAENIEAVLNAIIGKLERGESQVKSVYVKTTMGPAVKIEG

Entity 42 Entity 42 polymer

Description description	50S ribosomal protein L31E
Molecular weight formula_weight	10767.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

KAGEEVIFTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPKVNEKIWERGIEKPPSKLRVKVKVEEEKREGEETVRIAYVTLA

Entity 43 Entity 43 polymer

Description description	50S ribosomal protein L2
Molecular weight formula_weight	26085.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MGKSLIQQRRGKGSPTFKSPSHRFRGAVKYIPLNYTQEKTLRGVVEEIMHDPGRTAPVARVKFENGIEKLIIAPEGLLVGQEIYIGPDAPIAVGNTLPLAKIPEGTYVYNIEGIPGDGGKYVRAGGTYALVVSREPDKVIVQLPSGELKAFNPMCRATIGVVAGGGRLEKPLVKAGKAYYKYKARNKFWPTPRGVKMNAVNHPFGGKEHHPGKPTTTSRRAPPGRKVGHIAARRTGRRK

Entity 44 Entity 44 polymer

Description description	50S ribosomal protein L32E
Molecular weight formula_weight	15231.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

EKEFKRLLRVRARLKRKKPRFLRQEWWRYPKFKNDPKWRRPKGIDSKMRLKLKGKPRSPSIGWSSPKLVRGLHPSGYEEVLVHNVKELEALDPKRQAARIAHTVGKKKRIEIIKRAEELGIKVLNPR

Entity 45 Entity 45 polymer

Description description	50S ribosomal protein L3P
Molecular weight formula_weight	41466.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MGKVHRPRRGSLGFSPRKRAKSIVPRIRSWPKETEVRMLGFAGYKAGMTHILMIDDEPGLTNGKEIFMPVTIIETPPLRVFGIRAYRMGYLGLETATEVIVPDFPLDNYPAKERKGKPKPKMTFYKLLERRIATLPKNYTQEMFEQKLGQLEDMIKEGEIVDVRAIVATQPWVIKLKKKPEVMEYAIGGTSVEEKFNYIKEKLGKELRVGEVLKEGELLDVIAVTKGKGTQGPVKRWGIKLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENGKLKLDENTEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESKQ

Entity 46 Entity 46 polymer

Description description	50S ribosomal protein L4P
Molecular weight formula_weight	28765.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD

MKVKVFDLNGQPVGEIELPKVFFTPFRPDLIRRAVIASWTHRIQPQGRDPMAGKRRVTENIGKGHSMARVERLKTPPRYAAFVPFARGGRRTHPPKVEKIIWEDINKKEKRLALMSAIAATANYDLVRARGHIIDNVPQLPLIVVDDLQKVQKTRETREIFKKLGIWDDIVRAKEKSGVRAGKGKMRGRRYKKAKGPLIVVGKNEGIVLGARNHPGVDVVVVDNLGVEHLAPGTHPGRLTVWTVSAIERLRELYG

Entity 47 Entity 47 polymer

Description description	50S ribosomal protein L34E
Molecular weight formula_weight	10677.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MKPMYRSRSWRRKYVRTPGGRVVIHFERKKPKIAHCAMCGRPLNGIPRGRPVEMRKLPKTKKRPERPMPHLCPRCMRKVMKEQIRAQLS

Entity 48 Entity 48 polymer

Description description	50S ribosomal protein L5P
Molecular weight formula_weight	21269.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MAVEIPNKEQILADWEAHPMRRPRIEKVTINIGVGESGERLTKAEIMLQQLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYELLKRLLAAVDNRLKASSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEG

Entity 49 Entity 49 polymer

Description description	50S ribosomal protein L37E
Molecular weight formula_weight	7245.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

MGSGTATFGKRNSTPTHIRCRRCGRVSYNVKKGYCAACGFGRSRRLRKYRWSKKWKKKKNAH

Entity 50 Entity 50 polymer

Description description	50S ribosomal protein L6P
Molecular weight formula_weight	20891.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MPVDAWIREEVEIPEGVEVTVEGYKVKVKGPKGELEREFFWPGIQIFTEDGNVVIYKDFPRRKDVAIARTFAAHIRNMIKGVTEGFTYKLKVVYSHFPISVKVQGDEVIIENFLGEKAPRKAKILPGVTVKVRGQEIIVEGIDKEAVGQTAANIEQATRITKWDRRIFQDGIYIVEKAGKPITF

Entity 51 Entity 51 polymer

Description description	50S ribosomal protein L40E
Molecular weight formula_weight	5327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

RFPEAEARIFKKYVCLRCGATNPWGAKKCRKCGYKRLRPKAKEPR

Entity 52 Entity 52 polymer

Description description	50S ribosomal protein L11P
Molecular weight formula_weight	14160.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH

MPKQVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKDFAGMQVPVKIIVDPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGNLTMEQVIKIAKMKKDQMLALTLKAAAKEVIGTALSMG

Entity 53 Entity 53 polymer

Description description	50S ribosomal protein L41E
Molecular weight formula_weight	3277.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ah

MRWKWIKKRIRRLKRQRKKERGLI

Entity 54 Entity 54 polymer

Description description	50S ribosomal protein L13P
Molecular weight formula_weight	16345.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI

MRIINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAVITGNRDVIFKKYKQRTELRTLTNPRRGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIPKEFQGKELETIIEAHVSRLSRPKYVTVGEVAKFLGGKF

Entity 55 Entity 55 polymer

Description description	50S ribosomal protein L37AE
Molecular weight formula_weight	8451.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

KVGSAGRFGARYGLKIRRRVAAVEAKMRQKHTCPVCGRKAVKRISTGIWQCQKCGATFAGGAYLPVTPAGKAVRRITE

Entity 56 Entity 56 polymer

Description description	50S ribosomal protein L14P
Molecular weight formula_weight	14446.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

RGVSAVRPTRALPVGAYLTVADNSGAKVIQIIGVVEYHGTRRRLASAGVGDMVVATVKKGRPDMRHQVVRAVIIRQRKEYRRLDGMRVKFEDNAAVIVTPEGVPRGTEIRGPVAREAAERWVRIGSIASIIV

Entity 57 Entity 57 polymer

Description description	50S ribosomal protein L44E
Molecular weight formula_weight	11234.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MKYPKQIRTYCPFCKKHTIHKVERVKKRPRSELSAGQRRFRRILKGYGGFPRPKPEGREKPVKKLDLRFRCTECGKAHTRGRGFRVKKFELVEG

Entity 58 Entity 58 polymer

Description description	50S ribosomal protein P0/L10E
Molecular weight formula_weight	23257.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ak

EWKKKEVEELANLIKSYPVVALVDVSSMPAYPLSQMRRLIRENNGLLRVSRNTLIELAIKKVAQELGKPELEKLINYIEGGAGILVTTMNPFKLYKFLQQNRQPAPAKPGAKVPKDVVIPAGPTSLAPGPIVGQMQAMGIPARIERGKVTIQKDTVVLKAGEEITPELANILNALGIQPLEVGLDLLAVYEDGIIYTPDVLAIDESEYINML

Entity 59 Entity 59 polymer

Description description	50S ribosomal protein L15P
Molecular weight formula_weight	16439.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGKRGFSRPPEVQREVRVVNLKFIDEHLDELMQMGIAYEEGGKIIVDVTQFADKVLGTGKLTRPLVIKARAFSPKAEEKIKAAGGEAVLV

Entity 60 Entity 60 polymer

Description description	50S ribosomal protein L15E
Molecular weight formula_weight	22644.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

MGMYKYIREAWKSPKKSYVGELLKQRMIKWRREPVVVRIERPTRLDRARALGYQAKQGYVIVRVRVRKGGRKRPRWKGGRKPSKMGQVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWIALKHHKGRVFRGLTSAGKKGRGLRNKGKGAEKVRPSIRANEGKGK

Entity 61 Entity 61 polymer

Description description	50S ribosomal protein L10E/L16
Molecular weight formula_weight	19584.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

LRPAKIDRYVDKPAYTRREYIRGAPGPKITIFDMGNPAGDFEFEVSLHTAEPVQIRQNALEAARQQVNRYLQKNVGRSNYHFKIRVYPFQVLRENPMATGRKADRYGNGMRRPFGKPIGLAARLKKDQKILSIRVNRQHLKFAIEGARRAAMKFPCKCYYRIYDKEGN

Entity 62 Entity 62 polymer

Description description	50S ribosomal protein L18P
Molecular weight formula_weight	22633.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MAHGPRYRVPFRRRREGKTNYRKRLKLLKSGKPRLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELIRDFGWKGHCGNTPSAYLLGLLIGYKAKQAGIEEAILDIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFPDEYRIRGEHIAEYAKMLKEQDEEKFRRQFGGYLVKGLDPEKLPEHFEEVKARIIEKFE

Entity 63 Entity 63 polymer

Description description	50S ribosomal protein L18E
Molecular weight formula_weight	13758.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MKRTGPTDPNLRRLIRYLRKKSNEYGVKIWKDVAWRLERPRRQRAEVNVSKINRYANDGEMIVVPGSVLGAGKLEKKVIVAAWKFSETARRKIIEAGGEAITIEELIERNPTGSGVRIME

Entity 64 Entity 64 polymer

Description description	50S ribosomal protein L21E
Molecular weight formula_weight	11141.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

QKAHSFRRKTRKKLSKHPRRRGLPPLTRFLQEFEVGQRVHIVIEPSYHKGMPDPRFHGRTGTVVGKRGEAYIVEIKDGSKVKTLFIHPVHLRPQK

Entity 65 Entity 65 polymer

Description description	50S ribosomal protein L24E
Molecular weight formula_weight	7938.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV

MARWNVCSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQEARLQRGGE

Entity 66 Entity 66 polymer

Description description	50S ribosomal protein L30P
Molecular weight formula_weight	17745.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY

MAKLAVIRIRGRVNVKRPVRDTLAMLRLHRVNHCVIVDDTPSYLGMLQKAKDYITWGEINAETLAKLIRKRGRLIGNKPVTDEYVKEKLGMTIEEFAQKVVNGEMSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGALGYRGEKINELIERML

Entity 67 Entity 67 polymer

Description description	50S ribosomal protein L30E
Molecular weight formula_weight	10727.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

MDLAFELRKAMETGKVVLGSNETIRLAKTGGAKLIIVAKNAPKEIKDDIYYYAKLSDIPVYEFEGTSVELGTLLGKPFVVASLAIVDPGESKILAIAKR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.00 Å
Resolution测定Method resolution_method	projection matching
颗粒数 num_particles	37000

Structure of the Methanococcus jannaschii ribosome-SecYEBeta channel complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Preprotein translocase subunit SecE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Preprotein translocase subunit SecG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein translocase subunit SecY

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v4n__assembly_1__model_1

4v4n__assembly_1__model_1 | I(q)

4v4n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (67)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer

Entity 18 Entity 18 polymer

Polymer Polymer

Entity 19 Entity 19 polymer

Polymer Polymer

Entity 20 Entity 20 polymer

Polymer Polymer

Entity 21 Entity 21 polymer