SAXSdb — 4v5i

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

LACTOCOCCUS PHAGE P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ORF16 × 3 ORF15 × 6 CALCIUM ION × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 27	ORF16 × 3 ORF15 × 6 CALCIUM ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q1RNF7_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AA； PDBConstruct 1–263； UniProt 2–264 Author chain AB； PDBConstruct 1–263； UniProt 2–264 Author chain AC； PDBConstruct 1–263； UniProt 2–264 Author chain AD； PDBConstruct 1–263； UniProt 2–264 Author chain AE； PDBConstruct 1–263； UniProt 2–264 Author chain AF； PDBConstruct 1–263； UniProt 2–264 Author chain AG； PDBConstruct 1–263； UniProt 2–264 Author chain AH； PDBConstruct 1–263； UniProt 2–264 Author chain AI； PDBConstruct 1–263； UniProt 2–264 Author chain AJ； PDBConstruct 1–263； UniProt 2–264 Author chain AK； PDBConstruct 1–263； UniProt 2–264 Author chain AL； PDBConstruct 1–263； UniProt 2–264 Author chain AM； PDBConstruct 1–263； UniProt 2–264 Author chain AN； PDBConstruct 1–263； UniProt 2–264 Author chain AO； PDBConstruct 1–263； UniProt 2–264 Author chain AP； PDBConstruct 1–263； UniProt 2–264 Author chain AQ； PDBConstruct 1–263； UniProt 2–264 Author chain AR； PDBConstruct 1–263； UniProt 2–264 Author chain BA； PDBConstruct 1–263； UniProt 2–264 Author chain BB； PDBConstruct 1–263； UniProt 2–264 Author chain BC； PDBConstruct 1–263； UniProt 2–264 Author chain BD； PDBConstruct 1–263； UniProt 2–264 Author chain BE； PDBConstruct 1–263； UniProt 2–264 Author chain BF； PDBConstruct 1–263； UniProt 2–264 Author chain BG； PDBConstruct 1–263； UniProt 2–264 Author chain BH； PDBConstruct 1–263； UniProt 2–264 Author chain BI； PDBConstruct 1–263； UniProt 2–264 Author chain BJ； PDBConstruct 1–263； UniProt 2–264 Author chain BK； PDBConstruct 1–263； UniProt 2–264 Author chain BL； PDBConstruct 1–263； UniProt 2–264 Author chain BM； PDBConstruct 1–263； UniProt 2–264 Author chain BN； PDBConstruct 1–263； UniProt 2–264 Author chain BO； PDBConstruct 1–263； UniProt 2–264 Author chain BP； PDBConstruct 1–263； UniProt 2–264 Author chain BQ； PDBConstruct 1–263； UniProt 2–264 Author chain BR； PDBConstruct 1–263； UniProt 2–264

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v5i
Deposition date deposition_date	2010-02-05
Structure title title	Structure of the Phage P2 Baseplate in its Activated Conformation with Ca
Keywords keywords	VIRAL PROTEIN, SIPHOVIRIDAE, LACTOCOCCUS LACTIS; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v5i__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v5i__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v5i__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.16 Å
Rg (electron density)	75.51 Å
Total Rg	75.55 Å
Atom count	59742
Residues	7638
Excluded volume	1060700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v5i__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v5i__assembly_2__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ORF16
Molecular weight formula_weight	42542.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,AY,AZ,B0,BY,BZ
Atom count atom_count	119484

MLEANVYDNFNPNYYNISDFSMPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIEEALGKKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPNKNNLMSYGYFFNSSIFAGKATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHAPSETDPRNLLFINFASRNWNRKRITTRVDIKQSVTMDTETIVDRSAYNFAVVFVKNKATDDYTDPPKMYIAKNNGDVIDYSTYHGDGTDLPDVRTAKTLFYDRDDHGNPPELSTIKVEISPSTIVTRLIFNQNELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKP

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	PUTATIVE RECEPTOR BINDING PROTEIN
Molecular weight formula_weight	28536.9 kDa
Source method src_method	man
Copy count entity_count	36

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,AR,BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR

TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	ORF15
Molecular weight formula_weight	34512.0 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,AT,AU,AV,AW,AX,BS,BT,BU,BV,BW,BX

MVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	219.521 Å
Unit-cell length b length_b	219.337 Å
Unit-cell length c length_c	392.432 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.02 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	5.464 Å
Low-resolution limit resolution_low	44.563 Å
R factor r_factor	0.2912
R_work r_work	0.2908
R_free r_free	0.2974

Structure of the Phage P2 Baseplate in its Activated Conformation with Ca

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v5i__assembly_2__model_1

4v5i__assembly_2__model_1 | I(q)

4v5i__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)

Structure of the Phage P2 Baseplate in its Activated Conformation with Ca

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v5i__assembly_2__model_1

4v5i__assembly_2__model_1 | I(q)

4v5i__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)