2x53

Structure of the phage p2 baseplate in its activated conformation with Sr

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

LACTOCOCCUS PHAGE P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	ORF16 × 6 ORF15 × 12 STRONTIUM ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q1RNF7_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–263； UniProt 2–264 Author chain B； PDBConstruct 1–263； UniProt 2–264 Author chain C； PDBConstruct 1–263； UniProt 2–264 Author chain D； PDBConstruct 1–263； UniProt 2–264 Author chain E； PDBConstruct 1–263； UniProt 2–264 Author chain F； PDBConstruct 1–263； UniProt 2–264 Author chain G； PDBConstruct 1–263； UniProt 2–264 Author chain H； PDBConstruct 1–263； UniProt 2–264 Author chain I； PDBConstruct 1–263； UniProt 2–264 Author chain J； PDBConstruct 1–263； UniProt 2–264 Author chain K； PDBConstruct 1–263； UniProt 2–264 Author chain L； PDBConstruct 1–263； UniProt 2–264 Author chain M； PDBConstruct 1–263； UniProt 2–264 Author chain N； PDBConstruct 1–263； UniProt 2–264 Author chain O； PDBConstruct 1–263； UniProt 2–264 Author chain P； PDBConstruct 1–263； UniProt 2–264 Author chain Q； PDBConstruct 1–263； UniProt 2–264 Author chain R； PDBConstruct 1–263； UniProt 2–264

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2x53
Deposition date deposition_date	2010-02-05
Structure title title	Structure of the phage p2 baseplate in its activated conformation with Sr
Keywords keywords	BASEPLATE, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2x53__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2x53__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2x53__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	98.24 Å
Rg (electron density)	97.16 Å
Total Rg	97.07 Å
Atom count	119484
Residues	15276
Excluded volume	2121600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2x53__assembly_1__model_1`	54-meric （54）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ORF16
Molecular weight formula_weight	42869.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,Y,Z
Atom count atom_count	59742

MLEANVYDNFNPNYYNISDFSMPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIEEALGKKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPNKNNLMSYGYFFNSSIFAGKATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHAPSETDPRNLLFINFASRNWNRKRITTRVDIKQSVTMDTETIVDRSAYNFAVVFVKNKATDDYTDPPKMYIAKNNGDVIDYSTYHGDGTDLPDVRTAKTLFYDRDDHGNPPELSTIKVEISPSTIVTRLIFNQNELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKPNVI

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
Common name common_name	PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	PUTATIVE RECEPTOR BINDING PROTEIN
Molecular weight formula_weight	28536.9 kDa
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R

TIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
Common name common_name	PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	ORF15
Molecular weight formula_weight	34437.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U,V,W,X

GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV

Source Source

Source organism organism	LACTOCOCCUS PHAGE P2
Common name common_name	PHAGE P2
NCBI taxonomy ID ncbi_taxonomy_id	254252
Host organism host_organism	ESCHERICHIA COLI

Entity 4 Entity 4 non-polymer

Description description	STRONTIUM ION
Molecular weight formula_weight	87.6 kDa
Source method src_method	syn
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 57 domains

CATH v4.4 (57 domains)

Domain ID domain_id	2x53101
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	300 — Phage tail proteins - horseshoe like beta roll fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D1/D2

Domain ID domain_id	2x53102
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	50 — Phage tail protein beta-alpha-beta fold
Homologous superfamily homologous superfamily	50 — Phage tail base-plate attachment protein, domain D4

Domain ID domain_id	2x53103
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1920 — Phage tail proteins - 2 layer sandwich fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D3

Domain ID domain_id	2x53A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53C01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53C02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53D01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53D02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53E01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53E02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53F01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53F02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53G01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53G02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53H01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53H02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53I01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53I02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53J01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53J02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53K01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53K02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53L01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53L02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53M01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53M02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53N01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53N02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53O01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53O02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53P01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53P02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53Q01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53Q02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53R01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	520 — Triple-stranded beta-helix
Homologous superfamily homologous superfamily	10 — Phage fibre proteins

Domain ID domain_id	2x53R02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	2x53S01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53S02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53T01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53T02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53U01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53U02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53V01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53V02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53W01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53W02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53X01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	2x53X02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	880 —

Domain ID domain_id	2x53Y01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	300 — Phage tail proteins - horseshoe like beta roll fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D1/D2

Domain ID domain_id	2x53Y02
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	50 — Phage tail protein beta-alpha-beta fold
Homologous superfamily homologous superfamily	50 — Phage tail base-plate attachment protein, domain D4

Domain ID domain_id	2x53Y03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1920 — Phage tail proteins - 2 layer sandwich fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D3

Domain ID domain_id	2x53Z01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	300 — Phage tail proteins - horseshoe like beta roll fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D1/D2

Domain ID domain_id	2x53Z02
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	50 — Phage tail protein beta-alpha-beta fold
Homologous superfamily homologous superfamily	50 — Phage tail base-plate attachment protein, domain D4

Domain ID domain_id	2x53Z03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1920 — Phage tail proteins - 2 layer sandwich fold
Homologous superfamily homologous superfamily	20 — Phage tail base-plate attachment protein, domain D3

▶

Unit-cell length a length_a	300.278 Å
Unit-cell length b length_b	239.511 Å
Unit-cell length c length_c	274.782 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	124.36 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.900 Å
Low-resolution limit resolution_low	39.310 Å
R factor r_factor	0.2296
R_work r_work	0.2293
R_free r_free	0.2417

Structure of the phage p2 baseplate in its activated conformation with Sr

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2x53__assembly_1__model_1

2x53__assembly_1__model_1 | I(q)

2x53__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 57 domains

CATH v4.4 (57 domains)

7. Citations (1)

Structure of the phage p2 baseplate in its activated conformation with Sr

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE RECEPTOR BINDING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2x53__assembly_1__model_1

2x53__assembly_1__model_1 | I(q)

2x53__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 57 domains

CATH v4.4 (57 domains)

7. Citations (1)