4v98

The 8S snRNP Assembly Intermediate

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small nuclear ribonucleoprotein Sm D1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–119； UniProt 1–119 Author chain AI； PDBConstruct 1–119； UniProt 1–119 Author chain AQ； PDBConstruct 1–119； UniProt 1–119 Author chain AY； PDBConstruct 1–119； UniProt 1–119 Author chain Ag； PDBConstruct 1–119； UniProt 1–119 Author chain Ao； PDBConstruct 1–119； UniProt 1–119 Author chain Aw； PDBConstruct 1–119； UniProt 1–119 Author chain BA； PDBConstruct 1–119； UniProt 1–119 Author chain BI； PDBConstruct 1–119； UniProt 1–119 Author chain BQ； PDBConstruct 1–119； UniProt 1–119 Author chain BY； PDBConstruct 1–119； UniProt 1–119 Author chain Bg； PDBConstruct 1–119； UniProt 1–119 Author chain Bo； PDBConstruct 1–119； UniProt 1–119 Author chain Bw； PDBConstruct 1–119； UniProt 1–119 Author chain CA； PDBConstruct 1–119； UniProt 1–119 Author chain CI； PDBConstruct 1–119； UniProt 1–119 Author chain CQ； PDBConstruct 1–119； UniProt 1–119 Author chain CY； PDBConstruct 1–119； UniProt 1–119 Author chain Cg； PDBConstruct 1–119； UniProt 1–119 Author chain Co； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

Homo sapiens

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–118； UniProt 1–118 Author chain AJ； PDBConstruct 1–118； UniProt 1–118 Author chain AR； PDBConstruct 1–118； UniProt 1–118 Author chain AZ； PDBConstruct 1–118； UniProt 1–118 Author chain Ah； PDBConstruct 1–118； UniProt 1–118 Author chain Ap； PDBConstruct 1–118； UniProt 1–118 Author chain Ax； PDBConstruct 1–118； UniProt 1–118 Author chain BB； PDBConstruct 1–118； UniProt 1–118 Author chain BJ； PDBConstruct 1–118； UniProt 1–118 Author chain BR； PDBConstruct 1–118； UniProt 1–118 Author chain BZ； PDBConstruct 1–118； UniProt 1–118 Author chain Bh； PDBConstruct 1–118； UniProt 1–118 Author chain Bp； PDBConstruct 1–118； UniProt 1–118 Author chain Bx； PDBConstruct 1–118； UniProt 1–118 Author chain CB； PDBConstruct 1–118； UniProt 1–118 Author chain CJ； PDBConstruct 1–118； UniProt 1–118 Author chain CR； PDBConstruct 1–118； UniProt 1–118 Author chain CZ； PDBConstruct 1–118； UniProt 1–118 Author chain Ch； PDBConstruct 1–118； UniProt 1–118 Author chain Cp； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein E

Homo sapiens

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AC； PDBConstruct 1–92； UniProt 1–92 Author chain AK； PDBConstruct 1–92； UniProt 1–92 Author chain AS； PDBConstruct 1–92； UniProt 1–92 Author chain Aa； PDBConstruct 1–92； UniProt 1–92 Author chain Ai； PDBConstruct 1–92； UniProt 1–92 Author chain Aq； PDBConstruct 1–92； UniProt 1–92 Author chain Ay； PDBConstruct 1–92； UniProt 1–92 Author chain BC； PDBConstruct 1–92； UniProt 1–92 Author chain BK； PDBConstruct 1–92； UniProt 1–92 Author chain BS； PDBConstruct 1–92； UniProt 1–92 Author chain Ba； PDBConstruct 1–92； UniProt 1–92 Author chain Bi； PDBConstruct 1–92； UniProt 1–92 Author chain Bq； PDBConstruct 1–92； UniProt 1–92 Author chain By； PDBConstruct 1–92； UniProt 1–92 Author chain CC； PDBConstruct 1–92； UniProt 1–92 Author chain CK； PDBConstruct 1–92； UniProt 1–92 Author chain CS； PDBConstruct 1–92； UniProt 1–92 Author chain Ca； PDBConstruct 1–92； UniProt 1–92 Author chain Ci； PDBConstruct 1–92； UniProt 1–92 Author chain Cq； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

Homo sapiens

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AD； PDBConstruct 1–86； UniProt 1–86 Author chain AL； PDBConstruct 1–86； UniProt 1–86 Author chain AT； PDBConstruct 1–86； UniProt 1–86 Author chain Ab； PDBConstruct 1–86； UniProt 1–86 Author chain Aj； PDBConstruct 1–86； UniProt 1–86 Author chain Ar； PDBConstruct 1–86； UniProt 1–86 Author chain Az； PDBConstruct 1–86； UniProt 1–86 Author chain BD； PDBConstruct 1–86； UniProt 1–86 Author chain BL； PDBConstruct 1–86； UniProt 1–86 Author chain BT； PDBConstruct 1–86； UniProt 1–86 Author chain Bb； PDBConstruct 1–86； UniProt 1–86 Author chain Bj； PDBConstruct 1–86； UniProt 1–86 Author chain Br； PDBConstruct 1–86； UniProt 1–86 Author chain Bz； PDBConstruct 1–86； UniProt 1–86 Author chain CD； PDBConstruct 1–86； UniProt 1–86 Author chain CL； PDBConstruct 1–86； UniProt 1–86 Author chain CT； PDBConstruct 1–86； UniProt 1–86 Author chain Cb； PDBConstruct 1–86； UniProt 1–86 Author chain Cj； PDBConstruct 1–86； UniProt 1–86 Author chain Cr； PDBConstruct 1–86； UniProt 1–86

LD23602p

Drosophila melanogaster

UniProt Q9VV74

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9VV74_DROME
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A1； PDBConstruct 3–124； UniProt 1–122 Author chain AE； PDBConstruct 3–124； UniProt 1–122 Author chain AM； PDBConstruct 3–124； UniProt 1–122 Author chain AU； PDBConstruct 3–124； UniProt 1–122 Author chain Ac； PDBConstruct 3–124； UniProt 1–122 Author chain Ak； PDBConstruct 3–124； UniProt 1–122 Author chain As； PDBConstruct 3–124； UniProt 1–122 Author chain B1； PDBConstruct 3–124； UniProt 1–122 Author chain BE； PDBConstruct 3–124； UniProt 1–122 Author chain BM； PDBConstruct 3–124； UniProt 1–122 Author chain BU； PDBConstruct 3–124； UniProt 1–122 Author chain Bc； PDBConstruct 3–124； UniProt 1–122 Author chain Bk； PDBConstruct 3–124； UniProt 1–122 Author chain Bs； PDBConstruct 3–124； UniProt 1–122 Author chain CE； PDBConstruct 3–124； UniProt 1–122 Author chain CM； PDBConstruct 3–124； UniProt 1–122 Author chain CU； PDBConstruct 3–124； UniProt 1–122 Author chain Cc； PDBConstruct 3–124； UniProt 1–122 Author chain Ck； PDBConstruct 3–124； UniProt 1–122 Author chain Cs； PDBConstruct 3–124； UniProt 1–122

CG10419

Drosophila melanogaster

UniProt Q9VVX0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） Icln × 1 （Q9U3W1） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9VVX0_DROME
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A2； PDBConstruct 3–247； UniProt 1–245 Author chain AF； PDBConstruct 3–247； UniProt 1–245 Author chain AN； PDBConstruct 3–247； UniProt 1–245 Author chain AV； PDBConstruct 3–247； UniProt 1–245 Author chain Ad； PDBConstruct 3–247； UniProt 1–245 Author chain Al； PDBConstruct 3–247； UniProt 1–245 Author chain At； PDBConstruct 3–247； UniProt 1–245 Author chain B2； PDBConstruct 3–247； UniProt 1–245 Author chain BF； PDBConstruct 3–247； UniProt 1–245 Author chain BN； PDBConstruct 3–247； UniProt 1–245 Author chain BV； PDBConstruct 3–247； UniProt 1–245 Author chain Bd； PDBConstruct 3–247； UniProt 1–245 Author chain Bl； PDBConstruct 3–247； UniProt 1–245 Author chain Bt； PDBConstruct 3–247； UniProt 1–245 Author chain CF； PDBConstruct 3–247； UniProt 1–245 Author chain CN； PDBConstruct 3–247； UniProt 1–245 Author chain CV； PDBConstruct 3–247； UniProt 1–245 Author chain Cd； PDBConstruct 3–247； UniProt 1–245 Author chain Cl； PDBConstruct 3–247； UniProt 1–245 Author chain Ct； PDBConstruct 3–247； UniProt 1–245

Icln

Drosophila melanogaster

UniProt Q9U3W1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9U3W1_DROME
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A3； PDBConstruct 1–180； UniProt 1–180 Author chain AG； PDBConstruct 1–180； UniProt 1–180 Author chain AO； PDBConstruct 1–180； UniProt 1–180 Author chain AW； PDBConstruct 1–180； UniProt 1–180 Author chain Ae； PDBConstruct 1–180； UniProt 1–180 Author chain Am； PDBConstruct 1–180； UniProt 1–180 Author chain Au； PDBConstruct 1–180； UniProt 1–180 Author chain B3； PDBConstruct 1–180； UniProt 1–180 Author chain BG； PDBConstruct 1–180； UniProt 1–180 Author chain BO； PDBConstruct 1–180； UniProt 1–180 Author chain BW； PDBConstruct 1–180； UniProt 1–180 Author chain Be； PDBConstruct 1–180； UniProt 1–180 Author chain Bm； PDBConstruct 1–180； UniProt 1–180 Author chain Bu； PDBConstruct 1–180； UniProt 1–180 Author chain CG； PDBConstruct 1–180； UniProt 1–180 Author chain CO； PDBConstruct 1–180； UniProt 1–180 Author chain CW； PDBConstruct 1–180； UniProt 1–180 Author chain Ce； PDBConstruct 1–180； UniProt 1–180 Author chain Cm； PDBConstruct 1–180； UniProt 1–180 Author chain Cu； PDBConstruct 1–180； UniProt 1–180

Small nuclear ribonucleoprotein G

Homo sapiens

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
17	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
18	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
19	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
20	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1） SULFATE ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 8	Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） LD23602p × 1 （Q9VV74） CG10419 × 1 （Q9VVX0） Icln × 1 （Q9U3W1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A4； PDBConstruct 1–76； UniProt 1–76 Author chain AH； PDBConstruct 1–76； UniProt 1–76 Author chain AP； PDBConstruct 1–76； UniProt 1–76 Author chain AX； PDBConstruct 1–76； UniProt 1–76 Author chain Af； PDBConstruct 1–76； UniProt 1–76 Author chain An； PDBConstruct 1–76； UniProt 1–76 Author chain Av； PDBConstruct 1–76； UniProt 1–76 Author chain B4； PDBConstruct 1–76； UniProt 1–76 Author chain BH； PDBConstruct 1–76； UniProt 1–76 Author chain BP； PDBConstruct 1–76； UniProt 1–76 Author chain BX； PDBConstruct 1–76； UniProt 1–76 Author chain Bf； PDBConstruct 1–76； UniProt 1–76 Author chain Bn； PDBConstruct 1–76； UniProt 1–76 Author chain Bv； PDBConstruct 1–76； UniProt 1–76 Author chain CH； PDBConstruct 1–76； UniProt 1–76 Author chain CP； PDBConstruct 1–76； UniProt 1–76 Author chain CX； PDBConstruct 1–76； UniProt 1–76 Author chain Cf； PDBConstruct 1–76； UniProt 1–76 Author chain Cn； PDBConstruct 1–76； UniProt 1–76 Author chain Cv； PDBConstruct 1–76； UniProt 1–76

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v98
Deposition date deposition_date	2012-05-15
Structure title title	The 8S snRNP Assembly Intermediate
Keywords keywords	Complex, Assembly Machinery, SPLICING; SPLICING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v98__assembly_11__model_1

Assembly 11 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v98__assembly_11__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v98__assembly_11__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.85 Å
Rg (electron density)	28.87 Å
Total Rg	29.60 Å
Atom count	6102
Residues	760
Excluded volume	109400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v98__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v98__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4v98__assembly_3__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4v98__assembly_4__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4v98__assembly_5__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4v98__assembly_6__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4v98__assembly_7__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4v98__assembly_8__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4v98__assembly_9__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4v98__assembly_10__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4v98__assembly_11__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`4v98__assembly_12__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`4v98__assembly_13__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`4v98__assembly_14__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
15	1	`4v98__assembly_15__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
16	1	`4v98__assembly_16__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
17	1	`4v98__assembly_17__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
18	1	`4v98__assembly_18__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
19	1	`4v98__assembly_19__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
20	1	`4v98__assembly_20__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,AA,AQ,AY,Ag,Ao,Aw,BA,BI,BQ,BY,Bg,Bo,Bw,CA,CI,CQ,CY,Cg,Co
Atom count atom_count	121990

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,AB,AR,AZ,Ah,Ap,Ax,BB,BJ,BR,BZ,Bh,Bp,Bx,CB,CJ,CR,CZ,Ch,Cp

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,AC,AS,Aa,Ai,Aq,Ay,BC,BK,BS,Ba,Bi,Bq,By,CC,CK,CS,Ca,Ci,Cq

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL,AD,AT,Ab,Aj,Ar,Az,BD,BL,BT,Bb,Bj,Br,Bz,CD,CL,CT,Cb,Cj,Cr

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	LD23602p
Molecular weight formula_weight	13362.5 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM,AE,AU,Ac,Ak,As,A1,BE,BM,BU,Bc,Bk,Bs,B1,CE,CM,CU,Cc,Ck,Cs

GAMSDETNAAVWDDSLLVKTYDESVGLAREALARRLADSTNKREEENAAAAEEEAGEISATGGATSPEPVSFKVGDYARATYVDGVDYEGAVVSINEEKGTCVLRYLGYENEQEVLLVDLLPSW

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	CG10419
Molecular weight formula_weight	28910.9 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN,AF,AV,Ad,Al,At,A2,BF,BN,BV,Bd,Bl,Bt,B2,CF,CN,CV,Cd,Cl,Ct

GAMQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFKDYI

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Icln
Molecular weight formula_weight	20599.4 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO,AG,AW,Ae,Am,Au,A3,BG,BO,BW,Be,Bm,Bu,B3,CG,CO,CW,Ce,Cm,Cu

MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYGDPPQQAVNGRNGGGSEAEVDEGNGSDEHDEDDNFEDAVDEQFGEVTECWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLHHHHHH

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP,AH,AX,Af,An,Av,A4,BH,BP,BX,Bf,Bn,Bv,B4,CH,CP,CX,Cf,Cn,Cv

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	10

▶

Unit-cell length a length_a	150.930 Å
Unit-cell length b length_b	356.810 Å
Unit-cell length c length_c	230.750 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.31 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	40

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	59.470 Å
R factor r_factor	0.2336
R_work r_work	0.2324
R_free r_free	0.2560

The 8S snRNP Assembly Intermediate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LD23602p

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CG10419

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Icln

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v98__assembly_11__model_1

4v98__assembly_11__model_1 | I(q)

4v98__assembly_11__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source