3jcr

3D structure determination of the humanU4/U6.U5 tri-snRNP complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hPrp6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 1–941； UniProt 1–941

U5-40K

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–357； UniProt 1–357

hBrr2

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–2136； UniProt 1–2136

hDim1

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–142； UniProt 1–142

hPrp8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

hPrp28

OrganismNot specified

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–820； UniProt 1–820

hSnu114

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–972； UniProt 1–972

SmB

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–240； UniProt 1–240 Author chain o； PDBConstruct 1–240； UniProt 1–240

SmD1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–119； UniProt 1–119 Author chain p； PDBConstruct 1–119； UniProt 1–119

SmD2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–118； UniProt 1–118 Author chain q； PDBConstruct 1–118； UniProt 1–118

SmD3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain R； PDBConstruct 1–126； UniProt 1–126 Author chain r； PDBConstruct 1–126； UniProt 1–126

SmE

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain S； PDBConstruct 1–92； UniProt 1–92 Author chain s； PDBConstruct 1–92； UniProt 1–92

SmF

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–86； UniProt 1–86 Author chain t； PDBConstruct 1–86； UniProt 1–86

SmG

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain U； PDBConstruct 1–76； UniProt 1–76 Author chain u； PDBConstruct 1–76； UniProt 1–76

LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 8； PDBConstruct 1–96； UniProt 1–96

LSm6

OrganismNot specified

UniProt P62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 6； PDBConstruct 1–80； UniProt 1–80

LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5； PDBConstruct 1–91； UniProt 1–91

LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 4； PDBConstruct 1–139； UniProt 1–139

LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 3； PDBConstruct 1–102； UniProt 1–102

LSm2

OrganismNot specified

UniProt Q9Y333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 2； PDBConstruct 1–95； UniProt 1–95

LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 7； PDBConstruct 1–103； UniProt 1–103

hPrp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain K； PDBConstruct 1–683； UniProt 1–683

hPrp4

OrganismNot specified

UniProt Q5T1M7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5T1M7_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain L； PDBConstruct 1–521； UniProt 1–521

hPrp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hSnu13 × 1 （P55769） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain J； PDBConstruct 1–499； UniProt 1–499

hSnu13

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSad1 × 1 （Q53GS9） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain I； PDBConstruct 1–128； UniProt 1–128

hSad1

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	hPrp6 × 1 （O94906） U5-40K × 1 （Q96DI7） hBrr2 × 1 （O75643） hDim1 × 1 （P83876） hPrp8 × 1 （Q6P2Q9） hPrp28 × 1 （Q9BUQ8） hSnu114 × 1 （Q15029） SmB × 2 （P14678） SmD1 × 2 （P62314） SmD2 × 2 （P62316） SmD3 × 2 （P62318） SmE × 2 （P62304） SmF × 2 （P62306） SmG × 2 （P62308） LSm8 × 1 （O95777） LSm6 × 1 （P62312） LSm5 × 1 （Q9Y4Y9） LSm4 × 1 （Q9Y4Z0） LSm3 × 1 （P62310） LSm2 × 1 （Q9Y333） LSm7 × 1 （Q9UK45） hPrp3 × 1 （O43395） hPrp4 × 1 （Q5T1M7） hPrp31 × 1 （Q8WWY3） hSnu13 × 1 （P55769） U4 snRNA × 1 U6 snRNA × 1 U5 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT2_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain V； PDBConstruct 1–565； UniProt 1–565

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3jcr
Deposition date deposition_date	2016-01-21
Structure title title	3D structure determination of the humanU4/U6.U5 tri-snRNP complex
Keywords keywords	snRNP, splicing, spliceosome, human; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3jcr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3jcr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3jcr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.81 Å
Rg (electron density)	87.49 Å
Total Rg	87.38 Å
Atom count	203
Residues	203
Excluded volume	1298600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3jcr__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	hPrp6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G
Atom count atom_count	9403

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 2 Entity 2 polymer

Description description	U5-40K
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 3 Entity 3 polymer

Description description	hBrr2
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 4 Entity 4 polymer

Description description	hDim1
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 5 Entity 5 polymer

Description description	hPrp8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 6 Entity 6 polymer

Description description	hPrp28
Molecular weight formula_weight	95785.1 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Entity 7 Entity 7 polymer

Description description	hSnu114
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 8 Entity 8 polymer

Description description	SmB
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 9 Entity 9 polymer

Description description	SmD1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,p

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 10 Entity 10 polymer

Description description	SmD2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,q

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 11 Entity 11 polymer

Description description	SmD3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 12 Entity 12 polymer

Description description	SmE
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 13 Entity 13 polymer

Description description	SmF
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 14 Entity 14 polymer

Description description	SmG
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 15 Entity 15 polymer

Description description	LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 16 Entity 16 polymer

Description description	LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 17 Entity 17 polymer

Description description	LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 18 Entity 18 polymer

Description description	LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 19 Entity 19 polymer

Description description	LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 20 Entity 20 polymer

Description description	LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 21 Entity 21 polymer

Description description	LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 22 Entity 22 polymer

Description description	hPrp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 23 Entity 23 polymer

Description description	hPrp4
Molecular weight formula_weight	58408.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MASSRASSTATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 24 Entity 24 polymer

Description description	hPrp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 25 Entity 25 polymer

Description description	hSnu13
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 26 Entity 26 polymer

Description description	hSad1
Molecular weight formula_weight	65481.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Entity 27 Entity 27 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46536.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCAUGACGACUUGAAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG

Entity 28 Entity 28 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	N

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 29 Entity 29 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36891.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCUCCGACAAGGCUA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	141109

3D structure determination of the human*U4/U6.U5* tri-snRNP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

hPrp6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5-40K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

hBrr2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

hDim1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

hPrp8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

hPrp28

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

hSnu114

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SmB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SmD1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SmD2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

3D structure determination of the humanU4/U6.U5 tri-snRNP complex