7abg

Human pre-Bact-1 spliceosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear cap-binding protein subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCBP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A5； PDBConstruct 1–790； UniProt 1–790

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A2； PDBConstruct 1–103； UniProt 1–103

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain z； PDBConstruct 1–125； UniProt 1–125

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–464； UniProt 1–464

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–357； UniProt 1–357

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain W； PDBConstruct 1–255； UniProt 1–255

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–225； UniProt 1–225

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain s； PDBConstruct 1–2136； UniProt 1–2136

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 1–144； UniProt 1–144

Nuclear cap-binding protein subunit 2

OrganismNot specified

UniProt P52298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCBP2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A1； PDBConstruct 1–156； UniProt 1–156

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain R； PDBConstruct 1–229； UniProt 1–229

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt Q9Y333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 9； PDBConstruct 1–102； UniProt 1–102

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain C； PDBConstruct 1–139； UniProt 1–139

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain H； PDBConstruct 1–91； UniProt 1–91

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt P62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain J； PDBConstruct 1–80； UniProt 1–80

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain A3； PDBConstruct 1–96； UniProt 1–96

Microfibrillar-associated protein 1

OrganismNot specified

UniProt P55081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFAP1_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain K； PDBConstruct 1–439； UniProt 1–439

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain y； PDBConstruct 1–110； UniProt 1–110

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain G； PDBConstruct 1–514； UniProt 1–514

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

Pre-mRNA-splicing factor 38A

OrganismNot specified

UniProt Q8NAV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PR38A_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain I； PDBConstruct 1–312； UniProt 1–312

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain P； PDBConstruct 1–420； UniProt 1–420

Splicing factor 3A subunit 1

OrganismNot specified

UniProt Q15459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain p； PDBConstruct 1–793； UniProt 1–793

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 4； PDBConstruct 1–501； UniProt 1–501

Transcription elongation regulator 1

OrganismNot specified

UniProt O14776

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCRG1_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain A4； PDBConstruct 1–1098； UniProt 1–1098

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain u； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain T； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain E； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain w； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain x； PDBConstruct 1–86； UniProt 1–86

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain v； PDBConstruct 1–536； UniProt 1–536

Smad nuclear-interacting protein 1

OrganismNot specified

UniProt Q8TAD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNIP1_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain 0； PDBConstruct 1–396； UniProt 1–396

Zinc finger matrin-type protein 2

OrganismNot specified

UniProt Q96NC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZMAT2_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain N； PDBConstruct 1–199； UniProt 1–199

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain r； PDBConstruct 1–972； UniProt 1–972

Serine/arginine repetitive matrix protein 1

OrganismNot specified

UniProt Q8IYB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM1_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Y； PDBConstruct 1–904； UniProt 1–904

Serine/arginine-rich splicing factor 1

OrganismNot specified

UniProt Q07955

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRSF1_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain A6； PDBConstruct 1–248； UniProt 1–248

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain a； PDBConstruct 1–118； UniProt 1–118 Author chain h； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain b； PDBConstruct 1–86； UniProt 1–86 Author chain i； PDBConstruct 1–86； UniProt 1–86

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain f； PDBConstruct 1–240； UniProt 1–240 Author chain m； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain e； PDBConstruct 1–126； UniProt 1–126 Author chain l； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain d； PDBConstruct 1–76； UniProt 1–76 Author chain k； PDBConstruct 1–76； UniProt 1–76

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain c； PDBConstruct 1–92； UniProt 1–92 Author chain j； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Ubiquitin-like protein 5 × 1 （Q9BZL1） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain g； PDBConstruct 1–119； UniProt 1–119 Author chain n； PDBConstruct 1–119； UniProt 1–119

Ubiquitin-like protein 5

OrganismNot specified

UniProt Q9BZL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） WW domain-binding protein 11 × 1 （Q9Y2W2） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBL5_HUMAN
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain q； PDBConstruct 1–73； UniProt 1–73

WW domain-binding protein 11

OrganismNot specified

UniProt Q9Y2W2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 4	Nuclear cap-binding protein subunit 1 × 1 （Q09161） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3A subunit 2 × 1 （Q15428） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Protein BUD31 homolog × 1 （P41223） Nuclear cap-binding protein subunit 2 × 1 （P52298） U5 snRNA × 1 Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U2 snRNA × 1 U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Microfibrillar-associated protein 1 × 1 （P55081） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Pleiotropic regulator 1 × 1 （O43660） MINX M3 pre-mRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor 38A × 1 （Q8NAV1） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Transcription elongation regulator 1 × 1 （O14776） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） Zinc finger matrin-type protein 2 × 1 （Q96NC0） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） U6 snRNA × 1 Serine/arginine-rich splicing factor 1 × 1 （Q07955） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Ubiquitin-like protein 5 × 1 （Q9BZL1） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WBP11_HUMAN
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain X； PDBConstruct 1–641； UniProt 1–641

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7abg
Deposition date deposition_date	2020-09-07
Structure title title	Human pre-Bact-1 spliceosome
Keywords keywords	Complex, spliceosome, catalytic activation, splicing; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7abg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7abg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7abg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	103.00 Å
Total Rg	103.00 Å
Atom count	73818
Residues	13395
Excluded volume	1184200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7abg__assembly_1__model_1`	58-meric （58）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (55)

Entity 1 Entity 1 polymer

Description description	Nuclear cap-binding protein subunit 1
Molecular weight formula_weight	91960.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5
Atom count atom_count	73818

MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA

Entity 2 Entity 2 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 3 Entity 3 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 4 Entity 4 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 5 Entity 5 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 6 Entity 6 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 7 Entity 7 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 8 Entity 8 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 9 Entity 9 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 10 Entity 10 polymer

Description description	Nuclear cap-binding protein subunit 2
Molecular weight formula_weight	18028.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1

MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ

Entity 11 Entity 11 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 12 Entity 12 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 13 Entity 13 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 14 Entity 14 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 15 Entity 15 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 16 Entity 16 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 17 Entity 17 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 18 Entity 18 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 19 Entity 19 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 20 Entity 20 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 21 Entity 21 polymer

Description description	Microfibrillar-associated protein 1
Molecular weight formula_weight	52050.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEFQFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEVEGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKTT

Entity 22 Entity 22 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 23 Entity 23 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 24 Entity 24 polymer

Description description	MINX M3 pre-mRNA
Molecular weight formula_weight	73712.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCAAUAUC

Entity 25 Entity 25 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 26 Entity 26 polymer

Description description	Pre-mRNA-splicing factor 38A
Molecular weight formula_weight	37563.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE

Entity 27 Entity 27 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	46959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP

Entity 28 Entity 28 polymer

Description description	Splicing factor 3A subunit 1
Molecular weight formula_weight	88991.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 29 Entity 29 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 30 Entity 30 polymer

Description description	Transcription elongation regulator 1
Molecular weight formula_weight	124083.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A4

MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK

Entity 31 Entity 31 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 32 Entity 32 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 33 Entity 33 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 34 Entity 34 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 35 Entity 35 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 36 Entity 36 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 37 Entity 37 polymer

Description description	Smad nuclear-interacting protein 1
Molecular weight formula_weight	45880.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS

Entity 38 Entity 38 polymer

Description description	Zinc finger matrin-type protein 2
Molecular weight formula_weight	23664.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Entity 39 Entity 39 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 40 Entity 40 polymer

Description description	Serine/arginine repetitive matrix protein 1
Molecular weight formula_weight	102600.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS

Entity 41 Entity 41 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 42 Entity 42 polymer

Description description	Serine/arginine-rich splicing factor 1
Molecular weight formula_weight	27798.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A6

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Entity 43 Entity 43 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,a

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 44 Entity 44 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,b

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 45 Entity 45 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,f

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 46 Entity 46 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,e

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 47 Entity 47 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,d

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 48 Entity 48 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,c

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 49 Entity 49 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n,g

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 50 Entity 50 polymer

Description description	Ubiquitin-like protein 5
Molecular weight formula_weight	8560.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Entity 51 Entity 51 polymer

Description description	WW domain-binding protein 11
Molecular weight formula_weight	70098.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL

Entity 52 Entity 52 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 53 Entity 53 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 54 Entity 54 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 55 Entity 55 non-polymer

Description description	7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE
Molecular weight formula_weight	803.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	7.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	84539

Human pre-Bact-1 spliceosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear cap-binding protein subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;U2 small nuclear ribonucleoprotein A' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;U2 small nuclear ribonucleoprotein B'' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 200 kDa helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein BUD31 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear cap-binding protein subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer