6zym

Human C Complex Spliceosome - High-resolution CORE

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Corepressor interacting with RBPJ 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIR1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 9； PDBConstruct 1–450； UniProt 1–450

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–1755； UniProt 1–1755

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–952； UniProt 1–952

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–536； UniProt 1–536

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain D； PDBConstruct 1–514； UniProt 1–514

Pre-mRNA-processing factor 17

OrganismNot specified

UniProt O60508

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP17_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain E； PDBConstruct 1–579； UniProt 1–579

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain F； PDBConstruct 1–357； UniProt 1–357

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–848； UniProt 1–848

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain P； PDBConstruct 1–218； UniProt 1–218

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Q； PDBConstruct 1–144； UniProt 1–144

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain R； PDBConstruct 1–229； UniProt 1–229

Serine/arginine repetitive matrix protein 2

OrganismNot specified

UniProt Q9UQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–2752； UniProt 1–2752

Pre-mRNA-splicing factor CWC22 homolog

OrganismNot specified

UniProt Q9HCG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC22_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–908； UniProt 1–908

Peptidyl-prolyl cis-trans isomerase-like 1

OrganismNot specified

UniProt Q9Y3C6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain V； PDBConstruct 1–166； UniProt 1–166

WD repeat-containing protein 70

OrganismNot specified

UniProt Q9NW82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WDR70_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain p； PDBConstruct 1–654； UniProt 1–654

Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16

OrganismNot specified

UniProt Q92620

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP16_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain r； PDBConstruct 1–1227； UniProt 1–1227

Pre-mRNA-splicing factor ISY1 homolog

OrganismNot specified

UniProt Q9ULR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISY1_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain s； PDBConstruct 1–285； UniProt 1–285

Pre-mRNA-splicing factor CWC25 homolog

OrganismNot specified

UniProt Q9NXE8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Splicing factor YJU2 × 1 （Q9BW85） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC25_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain t； PDBConstruct 1–425； UniProt 1–425

Splicing factor YJU2

OrganismNot specified

UniProt Q9BW85

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Protein FRG1 × 1 （Q14331） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YJU2_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain u； PDBConstruct 1–178； UniProt 1–178

Protein FRG1

OrganismNot specified

UniProt Q14331

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 21 RNA 5	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Corepressor interacting with RBPJ 1 × 1 （Q86X95） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre-mRNA × 2 WD repeat-containing protein 70 × 1 （Q9NW82） Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 × 1 （Q92620） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Pre-mRNA-splicing factor CWC25 homolog × 1 （Q9NXE8） Splicing factor YJU2 × 1 （Q9BW85） MAGNESIUM ION × 5 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FRG1_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain x； PDBConstruct 1–258； UniProt 1–258

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zym
Deposition date deposition_date	2020-08-02
Structure title title	Human C Complex Spliceosome - High-resolution CORE
Keywords keywords	human C complex, spliceosome, hC, human step 1 spliceosome, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zym__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zym__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zym__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.37 Å
Rg (electron density)	58.70 Å
Total Rg	58.60 Å
Atom count	48271
Residues	5678
Excluded volume	839310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zym__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	48271

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 2 Entity 2 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 3 Entity 3 polymer

Description description	U6 snRNA
Molecular weight formula_weight	25480.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACAC

Entity 4 Entity 4 polymer

Description description	Corepressor interacting with RBPJ 1
Molecular weight formula_weight	52441.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPGGTHTKVTQRE

Entity 5 Entity 5 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	207470.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYS

Entity 6 Entity 6 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	107225.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKF

Entity 7 Entity 7 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 8 Entity 8 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 9 Entity 9 polymer

Description description	Pre-mRNA-processing factor 17
Molecular weight formula_weight	65612.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Entity 10 Entity 10 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 11 Entity 11 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 12 Entity 12 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 13 Entity 13 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	25223.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRAS

Entity 14 Entity 14 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 15 Entity 15 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 16 Entity 16 polymer

Description description	Serine/arginine repetitive matrix protein 2
Molecular weight formula_weight	300255.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGPGPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPPLLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP

Entity 17 Entity 17 polymer

Description description	Pre-mRNA-splicing factor CWC22 homolog
Molecular weight formula_weight	105646.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERERDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKKGHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRVANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRREKSPAKQK

Entity 18 Entity 18 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 1
Molecular weight formula_weight	18257.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Entity 19 Entity 19 polymer

Description description	pre-mRNA
Molecular weight formula_weight	103979.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Y,Z

GGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGA

Entity 20 Entity 20 polymer

Description description	WD repeat-containing protein 70
Molecular weight formula_weight	73306.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MERSGPSEVTGSDASGPDPQLAVTMGFTGFGKKARTFDLEAMFEQTRRTAVERSRKTLEAREKEEEMNREKELRRQNEDIEPTSSRSNVVRDCSKSSSRDTSSSESEQSSDSSDDELIGPPLPPKMVGKPVNFMEEDILGPLPPPLNEEEEEAEEEEEEEEEEENPVHKIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEVENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAACQNGSIQIWDRNLTVHPKFHYKQAHDSGTDTSCVTFSYDGNVLASRGGDDSLKLWDIRQFNKPLFSASGLPTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQRKAKQAETLTQDYIITPHALPMFREPRQRSTRKQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTDDSNPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESDDEEAKNEPEWKKRKI

Entity 21 Entity 21 polymer

Description description	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
Molecular weight formula_weight	140720.6 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRREREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSHPGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSSRSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYRDSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEGEEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL

Entity 22 Entity 22 polymer

Description description	Pre-mRNA-splicing factor ISY1 homolog
Molecular weight formula_weight	33046.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY

Entity 23 Entity 23 polymer

Description description	Pre-mRNA-splicing factor CWC25 homolog
Molecular weight formula_weight	49769.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDVGAVKKKEEKLDWMYQGPGGMVNRDEYLLGRPIDKYVFEKMEEKEAGCSSETGLLPGSIFAPSGANSLLDMASKIREDPLFIIRKKEEEKKREVLNNPVKMKKIKELLQMSLEKKEKKKKKEKKKKHKKHKHRSSSSDRSSSEDEHSAGRSQKKMANSSPVLSKVPGYGLQVRNSDRNQGLQGPLTAEQKRGHGMKNHSRSRSSSHSPPRHASKKSTREAGSRDRRSRSLGRRSRSPRPSKLHNSKVNRRETGQTRSPSPKKEVYQRRHAPGYTRKLSAEELERKRQEMMENAKWREEERLNILKRHAKDEEREQRLEKLDSRDGKFIHRMKLESASTSSLEDRVKRNIYSLQRTSVALEKNFMKR

Entity 24 Entity 24 polymer

Description description	Splicing factor YJU2
Molecular weight formula_weight	21452.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRL

Entity 25 Entity 25 polymer

Description description	Protein FRG1
Molecular weight formula_weight	29227.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEPVFQNGKMALLASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYVKKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK

Entity 26 Entity 26 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 27 Entity 27 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6zymA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1570 — tt1808, chain A
Homologous superfamily homologous superfamily	40 — Pre-mRNA-processing-splicing factor 8 (Prp8), endonuclease domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	411539

Human C Complex Spliceosome - High-resolution CORE

1. Protein Identity and Related Structures Protein Identity & Related Structures

Corepressor interacting with RBPJ 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SNW domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pleiotropic regulator 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle 5-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Crooked neck-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor RBM22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer