6ff4

human Bact spliceosome core structure

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-binding motif protein, X-linked 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBMX2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–322； UniProt 1–322

BUD13 homolog

OrganismNot specified

UniProt Q9BRD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD13_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–619； UniProt 1–619

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–464； UniProt 1–464

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 8； PDBConstruct 1–895； UniProt 1–895

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B； PDBConstruct 1–972； UniProt 1–972

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain C； PDBConstruct 1–536； UniProt 1–536

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain D； PDBConstruct 1–514； UniProt 1–514

Pre-mRNA-processing factor 17

OrganismNot specified

UniProt O60508

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP17_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain E； PDBConstruct 1–579； UniProt 1–579

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–848； UniProt 1–848

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain P； PDBConstruct 1–420； UniProt 1–420

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–144； UniProt 1–144

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain R； PDBConstruct 1–229； UniProt 1–229

Serine/arginine repetitive matrix protein 2

OrganismNot specified

UniProt Q9UQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM2_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain S； PDBConstruct 1–2752； UniProt 1–2752

Peptidyl-prolyl cis-trans isomerase-like 1

OrganismNot specified

UniProt Q9Y3C6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL1_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain V； PDBConstruct 1–166； UniProt 1–166

Serine/arginine repetitive matrix protein 1

OrganismNot specified

UniProt Q8IYB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM1_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Y； PDBConstruct 1–904； UniProt 1–904

Peptidyl-prolyl cis-trans isomerase CWC27 homolog

OrganismNot specified

UniProt Q6UX04

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC27_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain s； PDBConstruct 1–472； UniProt 1–472

RING finger protein 113A

OrganismNot specified

UniProt O15541

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R113A_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain t； PDBConstruct 1–343； UniProt 1–343

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain u； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain v； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain x； PDBConstruct 1–86； UniProt 1–86

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain y； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 24 RNA 4	RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） U2 snRNA × 1 BUD13 homolog × 1 （Q9BRD0） U5 snRNA × 1 U6 snRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-processing factor 17 × 1 （O60508） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Protein BUD31 homolog × 1 （P41223） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） pre mRNA × 1 Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） RING finger protein 113A × 1 （O15541） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） MAGNESIUM ION × 4 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 10	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain z； PDBConstruct 1–125； UniProt 1–125

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ff4
Deposition date deposition_date	2018-01-03
Structure title title	human Bact spliceosome core structure
Keywords keywords	spliceosome, human, HELA, BACT, dynamics, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ff4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ff4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ff4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.29 Å
Rg (electron density)	73.02 Å
Total Rg	72.91 Å
Atom count	72392
Residues	8493
Excluded volume	1268800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ff4__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	RNA-binding motif protein, X-linked 2
Molecular weight formula_weight	37426.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	72392

MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLPKSRTAYSGGAEDLERELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRWRH

Entity 2 Entity 2 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 3 Entity 3 polymer

Description description	BUD13 homolog
Molecular weight formula_weight	70669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTPDPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISSPRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM

Entity 4 Entity 4 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 5 Entity 5 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34404.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUUU

Entity 6 Entity 6 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 7 Entity 7 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 8 Entity 8 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 9 Entity 9 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 10 Entity 10 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 11 Entity 11 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 12 Entity 12 polymer

Description description	Pre-mRNA-processing factor 17
Molecular weight formula_weight	65612.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Entity 13 Entity 13 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 14 Entity 14 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 15 Entity 15 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	46959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP

Entity 16 Entity 16 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 17 Entity 17 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 18 Entity 18 polymer

Description description	Serine/arginine repetitive matrix protein 2
Molecular weight formula_weight	300255.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGPGPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPPLLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP

Entity 19 Entity 19 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 1
Molecular weight formula_weight	18257.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Entity 20 Entity 20 polymer

Description description	Serine/arginine repetitive matrix protein 1
Molecular weight formula_weight	102600.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS

Entity 21 Entity 21 polymer

Description description	pre mRNA
Molecular weight formula_weight	153788.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GAAUACAAGCUCAUCCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGAGUCGAGGAGGACAUCUCAGCAAAAGAGAAGCUGCUGCGGGCGUCGGAGGACGAGCGGGACCGGGUGCUGGAGGAGCUGCACAAGGCAGAGGACAGCCUGCUGGCUGCCGACGAGACCGCCGCCAAGGUAUGUAUCAAGCUUACAAGACAGCUUUAAGGAGACCAAUAGAAACUGGGCAUGUGGAGACAGAGAAGACUCUUGGCCUCGAGAAACCUGUAACUGGAAUGUGUGUGGAGUGUGACUGAUAGAACACUACCUGAUUCUUAUGUAUUUACUGACCUGUGUUUUUUUGCUACUUUUUUUCUUUUCUCCCCUUCCCCUUUCCCUAUUUUUUUUCUUGCCCUGAUCCGGAAUUUGGAUCC

Entity 22 Entity 22 polymer

Description description	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
Molecular weight formula_weight	53941.2 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR

Entity 23 Entity 23 polymer

Description description	RING finger protein 113A
Molecular weight formula_weight	38847.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT

Entity 24 Entity 24 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 25 Entity 25 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 26 Entity 26 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 27 Entity 27 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 28 Entity 28 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 29 Entity 29 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 30 Entity 30 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	6ff4V00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	100 — Cyclophilin
Homologous superfamily homologous superfamily	10 — Cyclophilin-like

Domain ID domain_id	6ff4Y00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1390 — PWI domain
Homologous superfamily homologous superfamily	10 — PWI domain

Domain ID domain_id	6ff4s00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	100 — Cyclophilin
Homologous superfamily homologous superfamily	10 — Cyclophilin-like

Domain ID domain_id	6ff4v01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	6ff4v02
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17000

human Bact spliceosome core structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-binding motif protein, X-linked 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BUD13 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SNW domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pleiotropic regulator 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division cycle 5-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer