7qtt

Structural organization of a late activated human spliceosome (Baqr, core region)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3B subunit 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–86； UniProt 1–86

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–1304； UniProt 1–1304

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–424； UniProt 1–424

G-patch domain and KOW motifs-containing protein

OrganismNot specified

UniProt Q92917

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GPKOW_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–476； UniProt 1–476

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–464； UniProt 1–464

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–501； UniProt 1–501

BUD13 homolog

OrganismNot specified

UniProt Q9BRD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD13_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–619； UniProt 1–619

Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16

OrganismNot specified

UniProt O60231

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHX16_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–1041； UniProt 1–1041

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–514； UniProt 1–514

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain P； PDBConstruct 1–802； UniProt 1–802

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Q； PDBConstruct 1–229； UniProt 1–229

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain T； PDBConstruct 1–144； UniProt 1–144

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain U； PDBConstruct 1–420； UniProt 1–420

Peptidyl-prolyl cis-trans isomerase-like 4

OrganismNot specified

UniProt Q8WUA2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL4_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain V； PDBConstruct 1–492； UniProt 1–492

Pre-mRNA-splicing factor CWC22 homolog

OrganismNot specified

UniProt Q9HCG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC22_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 1–908； UniProt 1–908

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	Q9BZJ0-2
PDB entities	19
Chains and sequence ranges	Author chain X； PDBConstruct 1–848； UniProt 1–848

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Y； PDBConstruct 1–536； UniProt 1–536

RING finger protein 113A

OrganismNot specified

UniProt O15541

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R113A_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Z； PDBConstruct 1–343； UniProt 1–343

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain a； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain b； PDBConstruct 1–972； UniProt 1–972

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain h； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain i； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain j； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain k； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain l； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain m； PDBConstruct 1–76； UniProt 1–76

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain n； PDBConstruct 1–240； UniProt 1–240

Peptidyl-prolyl cis-trans isomerase-like 1

OrganismNot specified

UniProt Q9Y3C6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL1_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain p； PDBConstruct 1–166； UniProt 1–166

Serine/arginine repetitive matrix protein 2

OrganismNot specified

UniProt Q9UQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM2_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain q； PDBConstruct 1–2752； UniProt 1–2752

RING-type E3 ubiquitin-protein ligase PPIL2

OrganismNot specified

UniProt Q13356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 4	Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3B subunit 1 × 1 （O75533） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） BUD13 homolog × 1 （Q9BRD0） Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） Pleiotropic regulator 1 × 1 （O43660） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Peptidyl-prolyl cis-trans isomerase-like 4 × 1 （Q8WUA2） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） RING finger protein 113A × 1 （O15541） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U6snRNA × 1 U5 snRNA × 1 U2snRNA × 1 MINX × 1 Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein G × 1 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） ZINC ION × 12 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 7	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL2_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain u； PDBConstruct 1–520； UniProt 1–520

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7qtt
Deposition date deposition_date	2022-01-15
Structure title title	Structural organization of a late activated human spliceosome (Baqr, core region)
Keywords keywords	Spliceosome, helicase, Prp2, Aquarius, catalytic activation, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7qtt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7qtt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7qtt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	78.01 Å
Rg (electron density)	76.72 Å
Total Rg	76.12 Å
Atom count	73537
Residues	10102
Excluded volume	1252900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7qtt__assembly_1__model_1`	37-meric （37）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (41)

Entity 1 Entity 1 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	73537

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 2 Entity 2 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 3 Entity 3 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 4 Entity 4 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 5 Entity 5 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 6 Entity 6 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 7 Entity 7 polymer

Description description	G-patch domain and KOW motifs-containing protein
Molecular weight formula_weight	52299.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MADSKEGVLPLTAASTAPISFGFTRTSARRRLADSGDGAGPSPEEKDFLKTVEGRELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEAVPVEAYGLAMLRGMGWKPGEGIGRTFNQVVKPRVNSLRPKGLGLGANLTEAQALTPTGPSRMPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPDRQDGPAAKSEKAAPRSQHWLHRDLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDMLETLVPKAEGDRVMVVLGPQTGRVGHLLSRDRARSRALVQLPRENQVVELHYDAICQYMGPSDTDDD

Entity 8 Entity 8 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 9 Entity 9 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 10 Entity 10 polymer

Description description	BUD13 homolog
Molecular weight formula_weight	70669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTPDPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISSPRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM

Entity 11 Entity 11 polymer

Description description	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Molecular weight formula_weight	119443.6 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPARDFALRLWNKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG

Entity 12 Entity 12 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 13 Entity 13 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 14 Entity 14 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 15 Entity 15 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 16 Entity 16 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	46959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP

Entity 17 Entity 17 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 4
Molecular weight formula_weight	57324.2 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR

Entity 18 Entity 18 polymer

Description description	Pre-mRNA-splicing factor CWC22 homolog
Molecular weight formula_weight	105646.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERERDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKKGHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRVANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRREKSPAKQK

Entity 19 Entity 19 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 20 Entity 20 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 21 Entity 21 polymer

Description description	RING finger protein 113A
Molecular weight formula_weight	38847.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT

Entity 22 Entity 22 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 23 Entity 23 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 24 Entity 24 polymer

Description description	U6snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	d

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 25 Entity 25 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	e

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 26 Entity 26 polymer

Description description	U2snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	f

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 27 Entity 27 polymer

Description description	MINX
Molecular weight formula_weight	102348.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	g

GGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCAAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCU

Entity 28 Entity 28 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 29 Entity 29 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 30 Entity 30 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 31 Entity 31 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 32 Entity 32 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 33 Entity 33 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 34 Entity 34 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 35 Entity 35 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 1
Molecular weight formula_weight	18257.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Entity 36 Entity 36 polymer

Description description	Serine/arginine repetitive matrix protein 2
Molecular weight formula_weight	300255.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGPGPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPPLLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP

Entity 37 Entity 37 polymer

Description description	RING-type E3 ubiquitin-protein ligase PPIL2
Molecular weight formula_weight	58910.4 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSSW

Entity 38 Entity 38 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 39 Entity 39 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 40 Entity 40 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 41 Entity 41 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7qttA01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7qttA02
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7qttF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	7qttU01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	7qttV01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	100 — Cyclophilin
Homologous superfamily homologous superfamily	10 — Cyclophilin-like

Domain ID domain_id	7qttp01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	100 — Cyclophilin
Homologous superfamily homologous superfamily	10 — Cyclophilin-like

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	146157

Structural organization of a late activated human spliceosome (Baqr, core region)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3B subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PHD finger-like domain-containing protein 5A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

G-patch domain and KOW motifs-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BUD13 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer