6qx9

Structure of a human fully-assembled precatalytic spliceosome (pre-B complex).

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5O； PDBConstruct 1–357； UniProt 1–357

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B4； PDBConstruct 1–424； UniProt 1–424

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 13； PDBConstruct 1–126； UniProt 1–126 Author chain 23； PDBConstruct 1–126； UniProt 1–126 Author chain 43； PDBConstruct 1–126； UniProt 1–126 Author chain 53； PDBConstruct 1–126； UniProt 1–126

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 4B； PDBConstruct 1–522； UniProt 1–522

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 1e； PDBConstruct 1–92； UniProt 1–92 Author chain 2e； PDBConstruct 1–92； UniProt 1–92 Author chain 4e； PDBConstruct 1–92； UniProt 1–92 Author chain 5e； PDBConstruct 1–92； UniProt 1–92

U1 small nuclear ribonucleoprotein 70 kDa

OrganismNot specified

UniProt P08621

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 1K； PDBConstruct 1–437； UniProt 1–437

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 4C； PDBConstruct 1–499； UniProt 1–499

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 11； PDBConstruct 1–119； UniProt 1–119 Author chain 21； PDBConstruct 1–119； UniProt 1–119 Author chain 41； PDBConstruct 1–119； UniProt 1–119 Author chain 51； PDBConstruct 1–119； UniProt 1–119

RNA-binding protein 42

OrganismNot specified

UniProt Q9BTD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM42_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain R； PDBConstruct 1–480； UniProt 1–480

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 1f； PDBConstruct 1–86； UniProt 1–86 Author chain 2f； PDBConstruct 1–86； UniProt 1–86 Author chain 4f； PDBConstruct 1–86； UniProt 1–86 Author chain 5f； PDBConstruct 1–86； UniProt 1–86

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

UniProt P62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 66； PDBConstruct 1–80； UniProt 1–80

U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

OrganismNot specified

UniProt Q8WVK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR27_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain X； PDBConstruct 1–155； UniProt 1–155

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 12； PDBConstruct 1–118； UniProt 1–118 Author chain 22； PDBConstruct 1–118； UniProt 1–118 Author chain 42； PDBConstruct 1–118； UniProt 1–118 Author chain 52； PDBConstruct 1–118； UniProt 1–118

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 67； PDBConstruct 1–103； UniProt 1–103

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt Q9Y333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 62； PDBConstruct 1–95； UniProt 1–95

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 2B； PDBConstruct 1–225； UniProt 1–225

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain A2； PDBConstruct 1–209； UniProt 1–209

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain B2； PDBConstruct 1–895； UniProt 1–895

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 5C； PDBConstruct 1–854； UniProt 104–957

Probable ATP-dependent RNA helicase DDX23

Homo sapiens

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 5X； PDBConstruct 1–820； UniProt 1–820

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 1b； PDBConstruct 1–240； UniProt 1–240 Author chain 2b； PDBConstruct 1–240； UniProt 1–240 Author chain 4b； PDBConstruct 1–240； UniProt 1–240 Author chain 5b； PDBConstruct 1–240； UniProt 1–240

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain B5； PDBConstruct 1–86； UniProt 1–86

U1 small nuclear ribonucleoprotein A

OrganismNot specified

UniProt P09012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNRPA_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–282； UniProt 1–282

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain S； PDBConstruct 1–800； UniProt 1–800

NHP2-like protein 1

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 4D； PDBConstruct 1–128； UniProt 1–128

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 63； PDBConstruct 1–102； UniProt 1–102

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain B3； PDBConstruct 1–1217； UniProt 1–1217

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain 1g； PDBConstruct 1–76； UniProt 1–76 Author chain 2g； PDBConstruct 1–76； UniProt 1–76 Author chain 4g； PDBConstruct 1–76； UniProt 1–76 Author chain 5g； PDBConstruct 1–76； UniProt 1–76

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain 68； PDBConstruct 1–96； UniProt 1–96

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain 5A； PDBConstruct 1–2311； UniProt 25–2335

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain A3； PDBConstruct 1–501； UniProt 1–501

U4/U6.U5 tri-snRNP-associated protein 2

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT2_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain U； PDBConstruct 1–555； UniProt 1–555

Thioredoxin-like protein 4A

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain 5D； PDBConstruct 1–142； UniProt 1–142

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain 64； PDBConstruct 1–139； UniProt 1–139

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain BP； PDBConstruct 1–104； UniProt 1–104

U1 small nuclear ribonucleoprotein C

OrganismNot specified

UniProt P09234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1C_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain 1C； PDBConstruct 1–159； UniProt 1–159

Serine/threonine-protein kinase PRP4 homolog

OrganismNot specified

UniProt Q13523

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4B_HUMAN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain K； PDBConstruct 1–1007； UniProt 1–1007

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain 4A； PDBConstruct 1–683； UniProt 1–683

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–255； UniProt 1–255

Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1

OrganismNot specified

UniProt Q15459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain A1； PDBConstruct 1–282； UniProt 1–282 Author chain A1； PDBConstruct 309–647； UniProt 455–793

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain 65； PDBConstruct 1–91； UniProt 1–91

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） Splicing factor 3B subunit 1 × 1 （O75533） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain 5B； PDBConstruct 1–2136； UniProt 1–2136

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 65 RNA 6	U1 snRNA × 1 U6 snRNA × 1 U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） Small nuclear ribonucleoprotein Sm D3 × 4 （P62318） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Small nuclear ribonucleoprotein E × 4 （P62304） AdML pre-mRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Small nuclear ribonucleoprotein Sm D1 × 4 （P62314） RNA-binding protein 42 × 1 （Q9BTD8） Small nuclear ribonucleoprotein F × 4 （P62306） U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein × 1 （Q8WVK2） Small nuclear ribonucleoprotein Sm D2 × 4 （P62316） U5 snRNA × 1 U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 4 （P14678） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U1 small nuclear ribonucleoprotein A × 1 （P09012） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Pre-mRNA-processing factor 6 × 1 NHP2-like protein 1 × 1 （P55769） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Small nuclear ribonucleoprotein G × 4 （P62308） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Splicing factor 3A subunit 3 × 1 （Q12874） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Thioredoxin-like protein 4A × 1 （P83876） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U1 small nuclear ribonucleoprotein C × 1 （P09234） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4 snRNA × 1 ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1 × 1 （Q15459） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） ZINC ION × 6 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain B1； PDBConstruct 1–1304； UniProt 1–1304

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qx9
Deposition date deposition_date	2019-03-07
Structure title title	Structure of a human fully-assembled precatalytic spliceosome (pre-B complex).
Keywords keywords	RNP complex, splicing, RNA, protein, spliceosome; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qx9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qx9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qx9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	122.10 Å
Total Rg	122.10 Å
Atom count	137439
Residues	16151
Excluded volume	2413400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qx9__assembly_1__model_1`	71-meric （71）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (54)

Entity 1 Entity 1 polymer

Description description	U1 snRNA
Molecular weight formula_weight	52697.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	137494

AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGUGCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG

Entity 2 Entity 2 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 3 Entity 3 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5O

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 4 Entity 4 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 5 Entity 5 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	13,53,23,43

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 6 Entity 6 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4B

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 7 Entity 7 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5e,4e,1e,2e

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 8 Entity 8 polymer

Description description	AdML pre-mRNA
Molecular weight formula_weight	15279.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

GGGUGAGUACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCUUUCGUGCUGACC

Entity 9 Entity 9 polymer

Description description	U1 small nuclear ribonucleoprotein 70 kDa
Molecular weight formula_weight	51683.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1K

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE

Entity 10 Entity 10 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4C

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	41,11,51,21

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 12 Entity 12 polymer

Description description	RNA-binding protein 42
Molecular weight formula_weight	50477.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVPGIPTAVPAVPTVPTVPTVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPVGFGPGDRSHLDSPEAREAMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAAGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKEKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1f,2f,5f,4f

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 14 Entity 14 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	66

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 15 Entity 15 polymer

Description description	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
Molecular weight formula_weight	18915.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	22,42,52,12

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 17 Entity 17 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 18 Entity 18 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	67

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 19 Entity 19 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	62

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 20 Entity 20 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2B

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 21 Entity 21 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	24340.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQ

Entity 22 Entity 22 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 23 Entity 23 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	95968.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5C

LMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM

Entity 24 Entity 24 polymer

Description description	Probable ATP-dependent RNA helicase DDX23
Molecular weight formula_weight	95785.1 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5X

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Saccharomyces cerevisiae

Entity 25 Entity 25 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1b,2b,5b,4b

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 26 Entity 26 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 27 Entity 27 polymer

Description description	U1 small nuclear ribonucleoprotein A
Molecular weight formula_weight	31319.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK

Entity 28 Entity 28 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 29 Entity 29 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	97004.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5J

VPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRI

Entity 30 Entity 30 polymer

Description description	NHP2-like protein 1
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4D

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 31 Entity 31 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	63

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 32 Entity 32 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60170.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUAGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 33 Entity 33 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 34 Entity 34 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1g,2g,5g,4g

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 35 Entity 35 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	68

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 36 Entity 36 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	271508.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5A

MSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 37 Entity 37 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 38 Entity 38 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 2
Molecular weight formula_weight	64408.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRR

Entity 39 Entity 39 polymer

Description description	Thioredoxin-like protein 4A
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5D

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 40 Entity 40 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	64

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 41 Entity 41 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	11644.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKK

Entity 42 Entity 42 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	17415.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1C

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR

Entity 43 Entity 43 polymer

Description description	Serine/threonine-protein kinase PRP4 homolog
Molecular weight formula_weight	117265.0 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHKHKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGYESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKEKTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPIINESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSPKRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDILSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI

Entity 44 Entity 44 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4A

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 45 Entity 45 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46997.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

XAGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG

Entity 46 Entity 46 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 47 Entity 47 polymer

Description description	Splicing factor 3A subunit 1,Splicing factor 3A subunit 1,Splicing factor 3A subunit 1
Molecular weight formula_weight	71619.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVXXXXXXXXXXXXXXXXXXXXXXXXXXVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 48 Entity 48 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	65

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 49 Entity 49 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5B

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 50 Entity 50 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 51 Entity 51 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	man
Copy count entity_count	6

Entity 52 Entity 52 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 53 Entity 53 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 54 Entity 54 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.28 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	86146

Structure of a human fully-assembled precatalytic spliceosome (pre-B complex).

1. Protein Identity and Related Structures Protein Identity & Related Structures

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein Prp4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein 70 kDa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U4/U6 small nuclear ribonucleoprotein Prp31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA-binding protein 42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer