8y6o

Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U11 and tri-snRNP part

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–972； UniProt 1–972

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–2136； UniProt 1–2136

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–357； UniProt 1–357

Pre-mRNA-processing factor 6

OrganismNot specified

UniProt O94906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–941； UniProt 1–941

Thioredoxin-like protein 4B

OrganismNot specified

UniProt Q9NX01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4B_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–149； UniProt 1–149

Probable ATP-dependent RNA helicase DDX23

OrganismNot specified

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–820； UniProt 1–820

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain a； PDBConstruct 1–240； UniProt 1–240 Author chain h； PDBConstruct 1–240； UniProt 1–240 Author chain o； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain b； PDBConstruct 1–119； UniProt 1–119 Author chain i； PDBConstruct 1–119； UniProt 1–119 Author chain p； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain c； PDBConstruct 1–118； UniProt 1–118 Author chain j； PDBConstruct 1–118； UniProt 1–118 Author chain q； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain d； PDBConstruct 1–126； UniProt 1–126 Author chain k； PDBConstruct 1–126； UniProt 1–126 Author chain r； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain e； PDBConstruct 1–92； UniProt 1–92 Author chain l； PDBConstruct 1–92； UniProt 1–92 Author chain s； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain m； PDBConstruct 1–86； UniProt 1–86 Author chain t； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain g； PDBConstruct 1–76； UniProt 1–76 Author chain n； PDBConstruct 1–76； UniProt 1–76 Author chain u； PDBConstruct 1–76； UniProt 1–76

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain L； PDBConstruct 1–499； UniProt 1–499

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain M； PDBConstruct 1–522； UniProt 1–522

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain N； PDBConstruct 1–683； UniProt 1–683

NHP2-like protein 1

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain O； PDBConstruct 1–128； UniProt 1–128

Centrosomal AT-AC splicing factor

OrganismNot specified

UniProt Q86UT8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CATAC_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain R； PDBConstruct 1–332； UniProt 1–332

Zinc finger matrin-type protein 5

OrganismNot specified

UniProt Q9UDW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZMAT5_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain V； PDBConstruct 1–170； UniProt 1–170

U11/U12 small nuclear ribonucleoprotein 35 kDa protein

OrganismNot specified

UniProt Q16560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U1SBP_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain W； PDBConstruct 1–246； UniProt 1–246

U11/U12 small nuclear ribonucleoprotein 25 kDa protein

OrganismNot specified

UniProt Q9BV90

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR25_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain X； PDBConstruct 1–132； UniProt 1–132

U11/U12 small nuclear ribonucleoprotein 48 kDa protein

OrganismNot specified

UniProt Q6IEG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR48_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Y； PDBConstruct 1–339； UniProt 1–339

Programmed cell death protein 7

OrganismNot specified

UniProt Q8N8D1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PDCD7_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Z； PDBConstruct 1–485； UniProt 1–485

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain S； PDBConstruct 1–800； UniProt 1–800

U4/U6.U5 tri-snRNP-associated protein 2

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） Serine/threonine-protein kinase PRP4 homolog × 1 （Q13523） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT2_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain U； PDBConstruct 1–565； UniProt 1–565

Serine/threonine-protein kinase PRP4 homolog

OrganismNot specified

UniProt Q13523

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 41 RNA 5	pre-mRNA × 1 U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-processing factor 6 × 1 （O94906） Thioredoxin-like protein 4B × 1 （Q9NX01） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein G × 3 （P62308） U4atac snRNA × 1 U6atac snRNA × 1 U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） NHP2-like protein 1 × 1 （P55769） Centrosomal AT-AC splicing factor × 1 （Q86UT8） U11 snRNA × 1 Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Programmed cell death protein 7 × 1 （Q8N8D1） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） U4/U6.U5 tri-snRNP-associated protein 2 × 1 （Q53GS9） MAGNESIUM ION × 2 INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4B_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Q； PDBConstruct 1–1007； UniProt 1–1007

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8y6o
Deposition date deposition_date	2024-02-02
Structure title title	Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U11 and tri-snRNP part
Keywords keywords	;spliceosome, minor spliceosome, U11 snRNP, U12 snRNP, U4atac, U6atac, CENATAC, TXNL4B, U11 snRNA, minor tri-snRNP, U12-type intron, SPLICING/RNA, SPLICING-RNA complex ;; SPLICING/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8y6o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8y6o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8y6o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	95.99 Å
Rg (electron density)	95.24 Å
Total Rg	95.41 Å
Atom count	101504
Residues	11916
Excluded volume	1782700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8y6o__assembly_1__model_1`	46-meric （46）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	pre-mRNA
Molecular weight formula_weight	89522.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	101504

GAAUACACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAAAUAUCCUUUUCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGACACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUAUCCUUAACUCAUUGUCCCUUUUUUUUC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 3 Entity 3 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 4 Entity 4 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 5 Entity 5 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 6 Entity 6 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 7 Entity 7 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 8 Entity 8 polymer

Description description	Thioredoxin-like protein 4B
Molecular weight formula_weight	17034.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Entity 9 Entity 9 polymer

Description description	Probable ATP-dependent RNA helicase DDX23
Molecular weight formula_weight	95785.1 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Entity 10 Entity 10 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,h,o

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,i,p

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,j,q

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,k,r

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 14 Entity 14 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,l,s

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,m,t

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,n,u

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 17 Entity 17 polymer

Description description	U4atac snRNA
Molecular weight formula_weight	42049.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	J

XAACCAUCCUUUUCUUGGGGUUGCGCUACUGUCCAAUGAGCGCAUAGUGAGGGCAGUACUGCUAACGCCUGAACAACACACCCGCAUCAACUAGAGCUUUUGCUUUAUUUUGGUGCAAUUUUUGGAAAAAU

Entity 18 Entity 18 polymer

Description description	U6atac snRNA
Molecular weight formula_weight	40221.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	K

GUGUUGUAUGAAAGGAGAGAAGGUUAGCACUCCCCUUGACAAGGAUGGAAGAGGCCCUCGGGCCUGACAACACGCAUACGGUUAAGGCAUUGCCACCUACUUCGUGGCAUCUAACCAUCGUUUUU

Entity 19 Entity 19 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 20 Entity 20 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 21 Entity 21 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 22 Entity 22 polymer

Description description	NHP2-like protein 1
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 23 Entity 23 polymer

Description description	Centrosomal AT-AC splicing factor
Molecular weight formula_weight	38034.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCGCEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPAPELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS

Entity 24 Entity 24 polymer

Description description	U11 snRNA
Molecular weight formula_weight	43505.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

AAAAAGGGCUUCUGUCGUGAGUGGCACACGUAGGGCAACUCGAUUGCUCUGCGUGCGGAAUCGACAUCAAGAGAUUUCGGAAGCAUAAUUUUUUGGUAUUUGGGCAGCUGGUGAUCGUUGGUCCCGGCGCCCUUU

Entity 25 Entity 25 polymer

Description description	Zinc finger matrin-type protein 5
Molecular weight formula_weight	20002.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG

Entity 26 Entity 26 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 35 kDa protein
Molecular weight formula_weight	29514.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK

Entity 27 Entity 27 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 25 kDa protein
Molecular weight formula_weight	15290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

Entity 28 Entity 28 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 48 kDa protein
Molecular weight formula_weight	40042.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI

Entity 29 Entity 29 polymer

Description description	Programmed cell death protein 7
Molecular weight formula_weight	54792.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPGTDAGERPRPPPPGPGPPWSPRWPEAPPPPADVLGDAALQRLRDRQWLEAVFGTPRRAGCPVPQRTHAGPSLGEVRARLLRALRLVRRLRGLSQALREAEADGAAWVLLYSQTAPLRAELAERLQPLTQAAYVGEARRRLERVRRRRLRLRERAREREAEREAEAARAVEREQEIDRWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH

Entity 30 Entity 30 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 31 Entity 31 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 2
Molecular weight formula_weight	65481.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Entity 32 Entity 32 polymer

Description description	Serine/threonine-protein kinase PRP4 homolog
Molecular weight formula_weight	117265.0 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHKHKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGYESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKEKTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPIINESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSPKRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDILSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 35 Entity 35 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 36 Entity 36 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Resolution resolution	3.38 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	388888

Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U11 and tri-snRNP part

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 200 kDa helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Thioredoxin-like protein 4B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable ATP-dependent RNA helicase DDX23

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer