8r7n

Overall structure of the U11 snRNP

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U11/U12 small nuclear ribonucleoprotein 25 kDa protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR25_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–132； UniProt 1–132

U11/U12 small nuclear ribonucleoprotein 35 kDa protein

OrganismNot specified

UniProt Q16560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U1SBP_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

Programmed cell death protein 7

OrganismNot specified

UniProt Q8N8D1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PDCD7_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–485； UniProt 1–485

Zinc finger matrin-type protein 5

OrganismNot specified

UniProt Q9UDW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZMAT5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–170； UniProt 1–170

U11/U12 small nuclear ribonucleoprotein 48 kDa protein

OrganismNot specified

UniProt Q6IEG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR48_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–339； UniProt 1–339

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain h； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain i； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain j； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain k； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain l； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain m； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	U11 snRNA × 1 U11/U12 small nuclear ribonucleoprotein 25 kDa protein × 1 （Q9BV90） U11/U12 small nuclear ribonucleoprotein 35 kDa protein × 1 （Q16560） Programmed cell death protein 7 × 1 （Q8N8D1） Zinc finger matrin-type protein 5 × 1 （Q9UDW3） U11/U12 small nuclear ribonucleoprotein 48 kDa protein × 1 （Q6IEG0） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain n； PDBConstruct 1–76； UniProt 1–76

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8r7n
Deposition date deposition_date	2023-11-26
Structure title title	Overall structure of the U11 snRNP
Keywords keywords	minor spliceosome, U11 snRNP, RNA-protein complex, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8r7n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8r7n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8r7n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.00 Å
Rg (electron density)	48.44 Å
Total Rg	48.20 Å
Atom count	13171
Residues	1438
Excluded volume	225860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8r7n__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	U11 snRNA
Molecular weight formula_weight	43505.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	13171

AAAAAGGGCUUCUGUCGUGAGUGGCACACGUAGGGCAACUCGAUUGCUCUGCGUGCGGAAUCGACAUCAAGAGAUUUCGGAAGCAUAAUUUUUUGGUAUUUGGGCAGCUGGUGAUCGUUGGUCCCGGCGCCCUUU

Entity 2 Entity 2 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 25 kDa protein
Molecular weight formula_weight	15290.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

Entity 3 Entity 3 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 35 kDa protein
Molecular weight formula_weight	29514.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK

Entity 4 Entity 4 polymer

Description description	Programmed cell death protein 7
Molecular weight formula_weight	54792.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPGTDAGERPRPPPPGPGPPWSPRWPEAPPPPADVLGDAALQRLRDRQWLEAVFGTPRRAGCPVPQRTHAGPSLGEVRARLLRALRLVRRLRGLSQALREAEADGAAWVLLYSQTAPLRAELAERLQPLTQAAYVGEARRRLERVRRRRLRLRERAREREAEREAEAARAVEREQEIDRWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH

Entity 5 Entity 5 polymer

Description description	Zinc finger matrin-type protein 5
Molecular weight formula_weight	20002.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG

Entity 6 Entity 6 polymer

Description description	U11/U12 small nuclear ribonucleoprotein 48 kDa protein
Molecular weight formula_weight	40042.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI

Entity 7 Entity 7 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 8 Entity 8 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 9 Entity 9 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 10 Entity 10 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	222666

Overall structure of the U11 snRNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

U11/U12 small nuclear ribonucleoprotein 25 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U11/U12 small nuclear ribonucleoprotein 35 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Programmed cell death protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger matrin-type protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U11/U12 small nuclear ribonucleoprotein 48 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer