7dvq

Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–972； UniProt 1–972

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–2136； UniProt 1–2136

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–357； UniProt 1–357

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain a； PDBConstruct 1–126； UniProt 1–126 Author chain h； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain b； PDBConstruct 1–240； UniProt 1–240 Author chain i； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain c； PDBConstruct 1–119； UniProt 1–119 Author chain j； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain d； PDBConstruct 1–118； UniProt 1–118 Author chain k； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain m； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain e； PDBConstruct 1–92； UniProt 1–92 Author chain l； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain g； PDBConstruct 1–76； UniProt 1–76 Author chain n； PDBConstruct 1–76； UniProt 1–76

Sodium channel modifier 1

OrganismNot specified

UniProt Q9BWG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCNM1_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain v； PDBConstruct 1–230； UniProt 1–230

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 1； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 2； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 3； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 4； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 5； PDBConstruct 1–125； UniProt 1–125

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 6； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 7； PDBConstruct 1–86； UniProt 1–86

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain J； PDBConstruct 1–848； UniProt 1–848

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain P； PDBConstruct 1–229； UniProt 1–229

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain R； PDBConstruct 1–536； UniProt 1–536

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain T； PDBConstruct 1–514； UniProt 1–514

Smad nuclear-interacting protein 1

OrganismNot specified

UniProt Q8TAD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNIP1_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain X； PDBConstruct 1–396； UniProt 1–396

RNA-binding motif protein, X-linked 2

OrganismNot specified

UniProt Q9Y388

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBMX2_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Y； PDBConstruct 1–322； UniProt 1–322

BUD13 homolog

OrganismNot specified

UniProt Q9BRD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD13_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Z； PDBConstruct 1–619； UniProt 1–619

RING-type E3 ubiquitin-protein ligase PPIL2

OrganismNot specified

UniProt Q13356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL2_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 9； PDBConstruct 1–520； UniProt 1–520

Peptidyl-prolyl cis-trans isomerase CWC27 homolog

OrganismNot specified

UniProt Q6UX04

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC27_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain z； PDBConstruct 1–472； UniProt 1–472

Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16

OrganismNot specified

UniProt O60231

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHX16_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain x； PDBConstruct 1–1041； UniProt 1–1041

G-patch domain and KOW motifs-containing protein

OrganismNot specified

UniProt Q92917

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GPKOW_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain y； PDBConstruct 1–476； UniProt 1–476

RING finger protein 113A

OrganismNot specified

UniProt O15541

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R113A_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain M； PDBConstruct 1–343； UniProt 1–343

Serine/arginine repetitive matrix protein 2

OrganismNot specified

UniProt Q9UQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM2_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain U； PDBConstruct 1–2752； UniProt 1–2752

Pre-mRNA-splicing factor CWC22 homolog

OrganismNot specified

UniProt Q9HCG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC22_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain V； PDBConstruct 1–908； UniProt 1–908

Serine/arginine repetitive matrix protein 1

OrganismNot specified

UniProt Q8IYB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM1_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain 8； PDBConstruct 1–904； UniProt 1–904

Cysteine-rich PDZ-binding protein

OrganismNot specified

UniProt Q9P021

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） RNA-binding protein 48 × 1 （Q5RL73） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRIPT_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain 0； PDBConstruct 1–101； UniProt 1–101

RNA-binding protein 48

OrganismNot specified

UniProt Q5RL73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） Armadillo repeat-containing protein 7 × 1 （Q9H6L4） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM48_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain I； PDBConstruct 1–367； UniProt 1–367

Armadillo repeat-containing protein 7

OrganismNot specified

UniProt Q9H6L4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） U6atac snRNA × 1 pre-mRNA × 1 U12 snRNA × 1 Sodium channel modifier 1 × 1 （Q9BWG6） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Cell division cycle 5-like protein × 1 （Q99459） Crooked neck-like protein 1 × 1 （Q9BZJ0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Pleiotropic regulator 1 × 1 （O43660） Smad nuclear-interacting protein 1 × 1 （Q8TAD8） RNA-binding motif protein, X-linked 2 × 1 （Q9Y388） BUD13 homolog × 1 （Q9BRD0） RING-type E3 ubiquitin-protein ligase PPIL2 × 1 （Q13356） Peptidyl-prolyl cis-trans isomerase CWC27 homolog × 1 （Q6UX04） Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 × 1 （O60231） G-patch domain and KOW motifs-containing protein × 1 （Q92917） RING finger protein 113A × 1 （O15541） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Serine/arginine repetitive matrix protein 1 × 1 （Q8IYB3） Cysteine-rich PDZ-binding protein × 1 （Q9P021） RNA-binding protein 48 × 1 （Q5RL73） INOSITOL HEXAKISPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 5 POTASSIUM ION × 2 5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine × 1 ZINC ION × 7 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARMC7_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain K； PDBConstruct 1–198； UniProt 1–198

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dvq
Deposition date deposition_date	2021-01-14
Structure title title	Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)
Keywords keywords	;spliceosome, minor spliceosome, Bact complex, human spliceosome, PPIL2, SCNM1, RBM48-ARMC7 complex, U12-type intron, U6atac snRNA, SPLICING ;; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dvq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dvq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dvq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.20 Å
Rg (electron density)	85.76 Å
Total Rg	84.88 Å
Atom count	99900
Residues	13597
Excluded volume	1722200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dvq__assembly_1__model_1`	49-meric （49）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (49)

Entity 1 Entity 1 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	99906

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 2 Entity 2 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 3 Entity 3 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 4 Entity 4 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 5 Entity 5 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 6 Entity 6 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,h

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 7 Entity 7 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,i

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 8 Entity 8 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,j

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 9 Entity 9 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,k

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 10 Entity 10 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,m

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 11 Entity 11 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,l

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,n

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 13 Entity 13 polymer

Description description	U6atac snRNA
Molecular weight formula_weight	39876.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	F

UGUUGUAUGAAAGGAGAGAAGGUUAGCACUCCCCUUGACAAGGAUGGAAGAGGCCCUCGGGCCUGACAACACGCAUACGGUUAAGGCAUUGCCACCUACUUCGUGGCAUCUAACCAUCGUUUUU

Entity 14 Entity 14 polymer

Description description	pre-mRNA
Molecular weight formula_weight	44322.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	G

GAAACCCGUCGGCCUCCGAAAUAUCCUUUUCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGNNNNNNNCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUAUCCUUAACUCAUUGUCCCUUUUUUUUC

Entity 15 Entity 15 polymer

Description description	U12 snRNA
Molecular weight formula_weight	48353.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

AUGCCUUAAACUUAUGAGUAAGGAAAAUAACGAUUCGGGGUGACGCCCGAAUCCUCACUGCUAAUGUGAGACGAAUUUUUGAGCGGGUAAAGGUCGCCCUCAAGGUGACCCGCCUACUUUGCGGGAUGCCUGGGAGUUGCGAUCUGCCCG

Entity 16 Entity 16 polymer

Description description	Sodium channel modifier 1
Molecular weight formula_weight	25993.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD

Entity 17 Entity 17 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146104.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 18 Entity 18 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 19 Entity 19 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135798.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 20 Entity 20 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 21 Entity 21 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 22 Entity 22 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 23 Entity 23 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 24 Entity 24 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 25 Entity 25 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 26 Entity 26 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 27 Entity 27 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61610.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 28 Entity 28 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 29 Entity 29 polymer

Description description	Smad nuclear-interacting protein 1
Molecular weight formula_weight	45880.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS

Entity 30 Entity 30 polymer

Description description	RNA-binding motif protein, X-linked 2
Molecular weight formula_weight	37426.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLPKSRTAYSGGAEDLERELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRWRH

Entity 31 Entity 31 polymer

Description description	BUD13 homolog
Molecular weight formula_weight	70669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEEEEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSPRKDRHDTPDPSPRRARHDTPDPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNSSGASPRRVRHDSPDPSPPRRARHGSSDISSPRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM

Entity 32 Entity 32 polymer

Description description	RING-type E3 ubiquitin-protein ligase PPIL2
Molecular weight formula_weight	58910.4 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSSW

Entity 33 Entity 33 polymer

Description description	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
Molecular weight formula_weight	53941.2 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR

Entity 34 Entity 34 polymer

Description description	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Molecular weight formula_weight	119443.6 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPARDFALRLWNKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG

Entity 35 Entity 35 polymer

Description description	G-patch domain and KOW motifs-containing protein
Molecular weight formula_weight	52299.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MADSKEGVLPLTAASTAPISFGFTRTSARRRLADSGDGAGPSPEEKDFLKTVEGRELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEAVPVEAYGLAMLRGMGWKPGEGIGRTFNQVVKPRVNSLRPKGLGLGANLTEAQALTPTGPSRMPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPDRQDGPAAKSEKAAPRSQHWLHRDLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDMLETLVPKAEGDRVMVVLGPQTGRVGHLLSRDRARSRALVQLPRENQVVELHYDAICQYMGPSDTDDD

Entity 36 Entity 36 polymer

Description description	RING finger protein 113A
Molecular weight formula_weight	38847.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT

Entity 37 Entity 37 polymer

Description description	Serine/arginine repetitive matrix protein 2
Molecular weight formula_weight	300255.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGPGPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPPLLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP

Entity 38 Entity 38 polymer

Description description	Pre-mRNA-splicing factor CWC22 homolog
Molecular weight formula_weight	105646.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERERDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKKGHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRVANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRREKSPAKQK

Entity 39 Entity 39 polymer

Description description	Serine/arginine repetitive matrix protein 1
Molecular weight formula_weight	102600.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS

Entity 40 Entity 40 polymer

Description description	Cysteine-rich PDZ-binding protein
Molecular weight formula_weight	11239.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Entity 41 Entity 41 polymer

Description description	RNA-binding protein 48
Molecular weight formula_weight	41878.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MASSGGELGSLFDHHVQRAVCDTRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGVMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSARTAKRKMDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGFCKAALNTSAGNSNPYLPYSCELPLCYFSSKCMCSSGGPVDRAPDSSKDGRNHHKTMGHYNHNDSLRKTQINSLKNSVACPGAQKAITSSEAVDRFMPRTTQLQERKRRREDDRKLGTFLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPKPPEDKPEDVHTSHPLKQRRRI

Entity 42 Entity 42 polymer

Description description	Armadillo repeat-containing protein 7
Molecular weight formula_weight	21946.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR

Entity 43 Entity 43 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 44 Entity 44 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 45 Entity 45 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 46 Entity 46 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 47 Entity 47 non-polymer

Description description	5'-O-[(S)-hydroxy{[(R)-hydroxy{[(S)-hydroxy(methoxy)phosphoryl]oxy}phosphoryl]oxy}phosphoryl]guanosine
Molecular weight formula_weight	537.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 49 Entity 49 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7dvq301
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7dvq302
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7dvq801
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1390 — PWI domain
Homologous superfamily homologous superfamily	10 — PWI domain

Domain ID domain_id	7dvq901
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	100 — Cyclophilin
Homologous superfamily homologous superfamily	10 — Cyclophilin-like

Domain ID domain_id	7dvqK01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	7dvqY01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

▶

Resolution resolution	2.89 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	101443

Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 200 kDa helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer