8y7e

Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U12 snRNP part

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3B subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 1–125； UniProt 1–125

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain h； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain i； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain j； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain k； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain l； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain m； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Sodium channel modifier 1 × 1 （Q9BWG6） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain n； PDBConstruct 1–76； UniProt 1–76

Sodium channel modifier 1

OrganismNot specified

UniProt Q9BWG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 15 RNA 2	pre-mRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U12 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） ZINC ION × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCNM1_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain v； PDBConstruct 1–230； UniProt 1–230

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8y7e
Deposition date deposition_date	2024-02-04
Structure title title	Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U12 snRNP part
Keywords keywords	;spliceosome, minor spliceosome, U11 snRNP, U12 snRNP, U4atac, U6atac, CENATAC, TXNL4B, U11 snRNA, minor tri-snRNP, U12-type intron, SPLICING/RNA, SPLICING-RNA complex ;; SPLICING/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8y7e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8y7e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8y7e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.65 Å
Rg (electron density)	55.86 Å
Total Rg	55.37 Å
Atom count	26949
Residues	3504
Excluded volume	469370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8y7e__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	pre-mRNA
Molecular weight formula_weight	89522.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	26949

GAAUACACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAAAUAUCCUUUUCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGACACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUAUCCUUAACUCAUUGUCCCUUUUUUUUC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146104.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 3 Entity 3 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 4 Entity 4 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135798.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 5 Entity 5 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 6 Entity 6 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 7 Entity 7 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 8 Entity 8 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 9 Entity 9 polymer

Description description	U12 snRNA
Molecular weight formula_weight	48353.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

AUGCCUUAAACUUAUGAGUAAGGAAAAUAACGAUUCGGGGUGACGCCCGAAUCCUCACUGCUAAUGUGAGACGAAUUUUUGAGCGGGUAAAGGUCGCCCUCAAGGUGACCCGCCUACUUUGCGGGAUGCCUGGGAGUUGCGAUCUGCCCG

Entity 10 Entity 10 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 11 Entity 11 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 12 Entity 12 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 13 Entity 13 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 14 Entity 14 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 17 Entity 17 polymer

Description description	Sodium channel modifier 1
Molecular weight formula_weight	25993.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD

Entity 18 Entity 18 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Resolution resolution	4.66 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	107724

Cryo-EM Structure of the human minor pre-B complex (pre-precatalytic spliceosome) U12 snRNP part

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3B subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PHD finger-like domain-containing protein 5A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer