SAXSdb — 4bwq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

THIOREDOXIN-LIKE PROTEIN 4A

HOMO SAPIENS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	POLYGLUTAMINE-BINDING PROTEIN 1 × 1 （O60828） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	POLYGLUTAMINE-BINDING PROTEIN 1 × 1 （O60828） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	POLYGLUTAMINE-BINDING PROTEIN 1 × 1 （O60828） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	POLYGLUTAMINE-BINDING PROTEIN 1 × 1 （O60828） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–142； UniProt 4–137 Author chain C； PDBConstruct 9–142； UniProt 4–137 Author chain E； PDBConstruct 9–142； UniProt 4–137 Author chain G； PDBConstruct 9–142； UniProt 4–137

POLYGLUTAMINE-BINDING PROTEIN 1

HOMO SAPIENS

UniProt O60828

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	THIOREDOXIN-LIKE PROTEIN 4A × 1 （P83876） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	THIOREDOXIN-LIKE PROTEIN 4A × 1 （P83876） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	THIOREDOXIN-LIKE PROTEIN 4A × 1 （P83876） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	THIOREDOXIN-LIKE PROTEIN 4A × 1 （P83876） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PQBP1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–43； UniProt 223–265 Author chain D； PDBConstruct 1–43； UniProt 223–265 Author chain F； PDBConstruct 1–43； UniProt 223–265 Author chain H； PDBConstruct 1–43； UniProt 223–265

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4bwq
Deposition date deposition_date	2013-07-04
Structure title title	Crystal structure of U5-15kD in a complex with PQBP1
Keywords keywords	TRANSCRIPTION, NEURODEGENERATIVE DISORDERS; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4bwq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4bwq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4bwq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.61 Å
Rg (electron density)	15.30 Å
Total Rg	16.45 Å
Atom count	1295
Residues	159
Excluded volume	23102 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4bwq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4bwq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4bwq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4bwq__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	THIOREDOXIN-LIKE PROTEIN 4A
Molecular weight formula_weight	16743.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	5437

MAHHHHHHMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	POLYGLUTAMINE-BINDING PROTEIN 1
Molecular weight formula_weight	4606.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

KRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	263

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4bwqa_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.8 — spliceosomal protein U5-15Kd

Domain ID domain_id	d4bwqc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.8 — spliceosomal protein U5-15Kd

Domain ID domain_id	d4bwqe_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.8 — spliceosomal protein U5-15Kd

Domain ID domain_id	d4bwqg_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.8 — spliceosomal protein U5-15Kd

CATH v4.4 (4 domains)

Domain ID domain_id	4bwqA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	4bwqC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	4bwqE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	4bwqG00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

▶

Unit-cell length a length_a	77.220 Å
Unit-cell length b length_b	40.040 Å
Unit-cell length c length_c	118.770 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.45 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 2 1
Space-group number int_tables_number	3
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	38.540 Å
R factor r_factor	0.1893
R_work r_work	0.1859
R_free r_free	0.2520

Crystal structure of U5-15kD in a complex with PQBP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

THIOREDOXIN-LIKE PROTEIN 4A

State in the Current Structure

Other States of the Same Protein in the Database

POLYGLUTAMINE-BINDING PROTEIN 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bwq__assembly_1__model_1

4bwq__assembly_1__model_1 | I(q)

4bwq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of U5-15kD in a complex with PQBP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

THIOREDOXIN-LIKE PROTEIN 4A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

POLYGLUTAMINE-BINDING PROTEIN 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bwq__assembly_1__model_1

4bwq__assembly_1__model_1 | I(q)

4bwq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)