7vpx

The cryo-EM structure of the human pre-A complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3A subunit 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–464； UniProt 1–464

Splicing factor 1

OrganismNot specified

UniProt Q15637

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF01_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–639； UniProt 1–639

DnaJ homolog subfamily C member 8

OrganismNot specified

UniProt O75937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DNJC8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–253； UniProt 1–253

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 2； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 3； PDBConstruct 1–1217； UniProt 1–1217

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 4； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 5； PDBConstruct 1–86； UniProt 1–86

Splicing factor 3A subunit 1

OrganismNot specified

UniProt Q15459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–793； UniProt 1–793

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain C； PDBConstruct 1–501； UniProt 1–501

Probable ATP-dependent RNA helicase DDX46

OrganismNot specified

UniProt Q7L014

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX46_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain E； PDBConstruct 1–1031； UniProt 1–1031

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain F； PDBConstruct 1–255； UniProt 1–255

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain G； PDBConstruct 1–225； UniProt 1–225

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain a； PDBConstruct 1–118； UniProt 1–118 Author chain i； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain b； PDBConstruct 1–86； UniProt 1–86 Author chain m； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain c； PDBConstruct 1–92； UniProt 1–92 Author chain l； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain d； PDBConstruct 1–76； UniProt 1–76 Author chain n； PDBConstruct 1–76； UniProt 1–76

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain e； PDBConstruct 1–126； UniProt 1–126 Author chain j； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain f； PDBConstruct 1–240； UniProt 1–240 Author chain k； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain g； PDBConstruct 1–119； UniProt 1–119 Author chain h； PDBConstruct 1–119； UniProt 1–119

U1 small nuclear ribonucleoprotein 70 kDa

OrganismNot specified

UniProt P08621

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain O； PDBConstruct 1–437； UniProt 1–437

U1 small nuclear ribonucleoprotein A

OrganismNot specified

UniProt P09012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNRPA_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain M； PDBConstruct 1–282； UniProt 1–282

U1 small nuclear ribonucleoprotein C

OrganismNot specified

UniProt P09234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1C_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain N； PDBConstruct 1–159； UniProt 1–159

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 31 RNA 4	Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 1 × 1 （Q15637） DnaJ homolog subfamily C member 8 × 1 （O75937） U2 snRNA × 1 Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 4 × 1 （Q15427） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） Splicing factor 3A subunit 1 × 1 （Q15459） Splicing factor 3A subunit 3 × 1 （Q12874） Probable ATP-dependent RNA helicase DDX46 × 1 （Q7L014） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） pre-mRNA × 1 5SS × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 6 spliceostatin A (form II) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 6； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7vpx
Deposition date deposition_date	2021-10-18
Structure title title	The cryo-EM structure of the human pre-A complex
Keywords keywords	human spliceosome, pre-A complex, PRP5, A complex, U1 snRNP, U2 snRNP, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7vpx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7vpx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7vpx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	99.72 Å
Total Rg	99.56 Å
Atom count	43240
Residues	5930
Excluded volume	715560 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7vpx__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	43240

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 2 Entity 2 polymer

Description description	Splicing factor 1
Molecular weight formula_weight	68401.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPPQN

Entity 3 Entity 3 polymer

Description description	DnaJ homolog subfamily C member 8
Molecular weight formula_weight	29900.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE

Entity 4 Entity 4 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 5 Entity 5 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 6 Entity 6 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 7 Entity 7 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 8 Entity 8 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 9 Entity 9 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 10 Entity 10 polymer

Description description	Splicing factor 3A subunit 1
Molecular weight formula_weight	88991.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 11 Entity 11 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 12 Entity 12 polymer

Description description	Probable ATP-dependent RNA helicase DDX46
Molecular weight formula_weight	117576.5 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRDRDRRRERSRSRDKRRSRSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSPGNKSKKTENRSRSKEKTDGGESSKEKKKDKDDKEDEKEKDAGNFDQNKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEIEEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Entity 13 Entity 13 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 14 Entity 14 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 15 Entity 15 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,i

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 16 Entity 16 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,m

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 17 Entity 17 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,l

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 18 Entity 18 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,n

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,j

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 20 Entity 20 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,k

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 21 Entity 21 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 22 Entity 22 polymer

Description description	pre-mRNA
Molecular weight formula_weight	83090.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I

GGGAGUGCAGUAGUCCAGGGUUUCCUUGAAGCUUUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCGAACGGUAAGAGCCUAGCAUGUAGAACCUUGGGAUCCGAAUACGGUACCAUCCGAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGAGUCGAG

Entity 23 Entity 23 polymer

Description description	5SS
Molecular weight formula_weight	3257.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	K

GGGUGAGUAC

Entity 24 Entity 24 polymer

Description description	U1 snRNA
Molecular weight formula_weight	52697.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	L

AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGUGCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG

Entity 25 Entity 25 polymer

Description description	U1 small nuclear ribonucleoprotein 70 kDa
Molecular weight formula_weight	51683.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE

Entity 26 Entity 26 polymer

Description description	U1 small nuclear ribonucleoprotein A
Molecular weight formula_weight	31319.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK

Entity 27 Entity 27 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	17415.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR

Entity 28 Entity 28 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 29 Entity 29 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 30 Entity 30 non-polymer

Description description	spliceostatin A (form II)
Molecular weight formula_weight	523.7 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7vpx301
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7vpx302
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	7vpx401
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	7vpxG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	7vpxM01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	7vpxO01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

▶

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	419522

The cryo-EM structure of the human pre-A complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Splicing factor 3A subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DnaJ homolog subfamily C member 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer