9fmd

Integrative model of the human post-catalytic spliceosome (P-complex)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PRKR-interacting protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PKRI1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–184； UniProt 1–184

Splicing factor ESS-2 homolog

OrganismNot specified

UniProt Q96DF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ESS2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–476； UniProt 1–476

Protein FAM32A

OrganismNot specified

UniProt Q9Y421

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FA32A_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 32； PDBConstruct 1–112； UniProt 1–112

Protein FAM50A

OrganismNot specified

UniProt Q14320

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FA50A_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 50； PDBConstruct 1–339； UniProt 1–339

STING ER exit protein

OrganismNot specified

UniProt Q9H5V9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STEEP_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 56； PDBConstruct 1–222； UniProt 1–222

Eukaryotic initiation factor 4A-III

OrganismNot specified

UniProt P38919

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF4A3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 7； PDBConstruct 1–411； UniProt 1–411

RNA-binding protein 8A

OrganismNot specified

UniProt Q9Y5S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM8A_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 8； PDBConstruct 1–174； UniProt 1–174

Protein mago nashi homolog

OrganismNot specified

UniProt P61326

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MGN_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 9； PDBConstruct 1–146； UniProt 1–146

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain B； PDBConstruct 1–2136； UniProt 1–2136

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain C； PDBConstruct 1–972； UniProt 1–972

Pre-mRNA-splicing factor ISY1 homolog

OrganismNot specified

UniProt Q9ULR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISY1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain D； PDBConstruct 1–285； UniProt 1–285

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain E； PDBConstruct 1–357； UniProt 1–357

Splicing factor Cactin

OrganismNot specified

UniProt Q8WUQ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CATIN_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain F； PDBConstruct 1–758； UniProt 1–758

Pre-mRNA-splicing factor CWC22 homolog

OrganismNot specified

UniProt Q9HCG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC22_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain H； PDBConstruct 1–908； UniProt 1–908

Pre-mRNA-splicing factor SYF1

OrganismNot specified

UniProt Q9HCS7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYF1_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain I； PDBConstruct 1–855； UniProt 1–855

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain J； PDBConstruct 1–848； UniProt 1–848

Pre-mRNA-splicing factor SPF27

OrganismNot specified

UniProt O75934

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPF27_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain K； PDBConstruct 1–225； UniProt 1–225

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

Pre-mRNA-splicing factor SYF2

OrganismNot specified

UniProt O95926

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYF2_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain M； PDBConstruct 1–243； UniProt 1–243

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain N； PDBConstruct 1–144； UniProt 1–144

Nitric oxide synthase-interacting protein

OrganismNot specified

UniProt Q9Y314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NOSIP_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain NO； PDBConstruct 1–301； UniProt 1–301

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain O； PDBConstruct 1–420； UniProt 1–420

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain P； PDBConstruct 1–229； UniProt 1–229

Intron-binding protein aquarius

OrganismNot specified

UniProt O60306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AQR_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Q； PDBConstruct 1–1485； UniProt 1–1485

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain R； PDBConstruct 1–536； UniProt 1–536

Peptidyl-prolyl cis-trans isomerase-like 1

OrganismNot specified

UniProt Q9Y3C6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL1_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain S； PDBConstruct 1–166； UniProt 1–166

Serine/arginine repetitive matrix protein 2

OrganismNot specified

UniProt Q9UQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRRM2_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain SR； PDBConstruct 1–2752； UniProt 1–2752

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain T； PDBConstruct 1–514； UniProt 1–514

Pre-mRNA-splicing factor SLU7

OrganismNot specified

UniProt O95391

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SLU7_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain U； PDBConstruct 1–586； UniProt 1–586

ATP-dependent RNA helicase DHX8

OrganismNot specified

UniProt Q14562

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHX8_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain V； PDBConstruct 1–1220； UniProt 1–1220

Pre-mRNA-processing factor 17

OrganismNot specified

UniProt O60508

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP17_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain W； PDBConstruct 1–579； UniProt 1–579

Splicing regulator SDE2

OrganismNot specified

UniProt Q6IQ49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SDE2_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain X； PDBConstruct 1–451； UniProt 1–451

Coiled-coil domain-containing protein 12

OrganismNot specified

UniProt Q8WUD4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCD12_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Z； PDBConstruct 1–166； UniProt 1–166

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain a； PDBConstruct 1–126； UniProt 1–126 Author chain h； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain b； PDBConstruct 1–240； UniProt 1–240 Author chain i； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain c； PDBConstruct 1–119； UniProt 1–119 Author chain j； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain d； PDBConstruct 1–118； UniProt 1–118 Author chain k； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain e； PDBConstruct 1–92； UniProt 1–92 Author chain l； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86 Author chain m； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain g； PDBConstruct 1–76； UniProt 1–76 Author chain n； PDBConstruct 1–76； UniProt 1–76

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain o； PDBConstruct 1–255； UniProt 1–255

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain p； PDBConstruct 1–225； UniProt 1–225

Pre-mRNA-processing factor 19

OrganismNot specified

UniProt Q9UMS4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP19_HUMAN
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain q； PDBConstruct 1–504； UniProt 1–504 Author chain r； PDBConstruct 1–504； UniProt 1–504 Author chain s； PDBConstruct 1–504； UniProt 1–504 Author chain t； PDBConstruct 1–504； UniProt 1–504

Peptidylprolyl isomerase domain and WD repeat-containing protein 1

OrganismNot specified

UniProt Q96BP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPWD1_HUMAN
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain w； PDBConstruct 1–646； UniProt 1–646

Splicing factor C9orf78

OrganismNot specified

UniProt Q9NZ63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLS1_HUMAN
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain x； PDBConstruct 1–289； UniProt 1–289

Peptidyl-prolyl cis-trans isomerase E

OrganismNot specified

UniProt Q9UNP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） NF-kappa-B-activating protein × 1 （Q8N5F7） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIE_HUMAN
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain y； PDBConstruct 1–301； UniProt 1–301

NF-kappa-B-activating protein

OrganismNot specified

UniProt Q8N5F7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 58 RNA 5	PRKR-interacting protein 1 × 1 （Q9H875） U2 snRNA × 1 Splicing factor ESS-2 homolog × 1 （Q96DF8） Protein FAM32A × 1 （Q9Y421） U5 snRNA × 1 Protein FAM50A × 1 （Q14320） STING ER exit protein × 1 （Q9H5V9） U6 snRNA × 1 Eukaryotic initiation factor 4A-III × 1 （P38919） RNA-binding protein 8A × 1 （Q9Y5S9） Protein mago nashi homolog × 1 （P61326） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Exon × 1 Splicing factor Cactin × 1 （Q8WUQ7） Pre-mRNA-splicing factor CWC22 homolog × 1 （Q9HCG8） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Protein BUD31 homolog × 1 （P41223） Nitric oxide synthase-interacting protein × 1 （Q9Y314） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Serine/arginine repetitive matrix protein 2 × 1 （Q9UQ35） Pleiotropic regulator 1 × 1 （O43660） Pre-mRNA-splicing factor SLU7 × 1 （O95391） ATP-dependent RNA helicase DHX8 × 1 （Q14562） Pre-mRNA-processing factor 17 × 1 （O60508） Splicing regulator SDE2 × 1 （Q6IQ49） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 2 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 2 （P14678） Small nuclear ribonucleoprotein Sm D1 × 2 （P62314） Small nuclear ribonucleoprotein Sm D2 × 2 （P62316） Small nuclear ribonucleoprotein E × 2 （P62304） Small nuclear ribonucleoprotein F × 2 （P62306） Small nuclear ribonucleoprotein G × 2 （P62308） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Peptidylprolyl isomerase domain and WD repeat-containing protein 1 × 1 （Q96BP3） Splicing factor C9orf78 × 1 （Q9NZ63） Peptidyl-prolyl cis-trans isomerase E × 1 （Q9UNP9） MAGNESIUM ION × 6 POTASSIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 6 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NKAP_HUMAN
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain z； PDBConstruct 1–415； UniProt 1–415

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9fmd
Deposition date deposition_date	2024-06-05
Structure title title	Integrative model of the human post-catalytic spliceosome (P-complex)
Keywords keywords	P-complex, spliceosome, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9fmd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9fmd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9fmd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	101.60 Å
Total Rg	100.90 Å
Atom count	120489
Residues	17107
Excluded volume	2060400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9fmd__assembly_1__model_1`	63-meric （63）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (59)

Entity 1 Entity 1 polymer

Description description	PRKR-interacting protein 1
Molecular weight formula_weight	21040.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	120489

MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR

Entity 2 Entity 2 polymer

Description description	U2 snRNA
Molecular weight formula_weight	59825.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAAGAUUUUUGGAACUGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 3 Entity 3 polymer

Description description	Splicing factor ESS-2 homolog
Molecular weight formula_weight	52640.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

METPGASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDVFLSRYTSEDNASFQEIMEVAKERSRARHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQASVETWKYKAKNSLMYYPEGVPDEEQLFKKPRQVVHKNTRFLRDPFSQALSRCQLQQAAALNAQHKQGKVGPDGKELIPQESPRVGGFGFVATPSPAPGVNESPMMTWGEVENTPLRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF

Entity 4 Entity 4 polymer

Description description	Protein FAM32A
Molecular weight formula_weight	13213.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	32

MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK

Entity 5 Entity 5 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 6 Entity 6 polymer

Description description	Protein FAM50A
Molecular weight formula_weight	40319.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	50

MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Entity 7 Entity 7 polymer

Description description	STING ER exit protein
Molecular weight formula_weight	25669.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	56

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFK

Entity 8 Entity 8 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 9 Entity 9 polymer

Description description	Eukaryotic initiation factor 4A-III
Molecular weight formula_weight	46931.0 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

Entity 10 Entity 10 polymer

Description description	RNA-binding protein 8A
Molecular weight formula_weight	19925.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

Entity 11 Entity 11 polymer

Description description	Protein mago nashi homolog
Molecular weight formula_weight	17189.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Entity 12 Entity 12 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 13 Entity 13 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 14 Entity 14 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 15 Entity 15 polymer

Description description	Pre-mRNA-splicing factor ISY1 homolog
Molecular weight formula_weight	33046.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY

Entity 16 Entity 16 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 17 Entity 17 polymer

Description description	Exon
Molecular weight formula_weight	4437.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	EX

GGCCUCCGAACGCU

Entity 18 Entity 18 polymer

Description description	Splicing factor Cactin
Molecular weight formula_weight	88860.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMRSRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSLQERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWGEEYMGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQEDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAEDDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYMELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGPNLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR

Entity 19 Entity 19 polymer

Description description	Pre-mRNA-splicing factor CWC22 homolog
Molecular weight formula_weight	105646.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGRSYDSSMESRNRDREKRRERERDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEGDTDSNTDQDAGSSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLNARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNTPKVIVAQKPDVEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKKGHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDPITKYTSDKDVPSERNNYSRVANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRIKDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRREKSPAKQK

Entity 20 Entity 20 polymer

Description description	Pre-mRNA-splicing factor SYF1
Molecular weight formula_weight	100148.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRVYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED

Entity 21 Entity 21 polymer

Description description	INTRON
Molecular weight formula_weight	27772.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	IN

GUAAGAGCCUAGCAUGUAGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNUGAUGAUGUCAUACUUAUCCUNNNNNNNNNCAG

Entity 22 Entity 22 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 23 Entity 23 polymer

Description description	Pre-mRNA-splicing factor SPF27
Molecular weight formula_weight	26163.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Entity 24 Entity 24 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 25 Entity 25 polymer

Description description	Pre-mRNA-splicing factor SYF2
Molecular weight formula_weight	28780.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV

Entity 26 Entity 26 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 27 Entity 27 polymer

Description description	Nitric oxide synthase-interacting protein
Molecular weight formula_weight	33224.1 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	NO

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

Entity 28 Entity 28 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	46959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP

Entity 29 Entity 29 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 30 Entity 30 polymer

Description description	Intron-binding protein aquarius
Molecular weight formula_weight	171502.5 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSEPVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPDVTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQNLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPSETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK

Entity 31 Entity 31 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61770.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 32 Entity 32 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 1
Molecular weight formula_weight	18257.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Entity 33 Entity 33 polymer

Description description	Serine/arginine repetitive matrix protein 2
Molecular weight formula_weight	300255.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	SR

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEKSKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSHSESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELKEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNSPLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSGHSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSPSSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGPGPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVGPRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPPLLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP

Entity 34 Entity 34 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 35 Entity 35 polymer

Description description	Pre-mRNA-splicing factor SLU7
Molecular weight formula_weight	68510.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVKKEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMYETREPTEEEMEAYRMKRQRPDDPMASFLGQ

Entity 36 Entity 36 polymer

Description description	ATP-dependent RNA helicase DHX8
Molecular weight formula_weight	139522.3 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFPVLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDRTKKKKRSRSRDRNRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRSRSRSQSPPKDRKDRDKYGERNLDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR

Entity 37 Entity 37 polymer

Description description	Pre-mRNA-processing factor 17
Molecular weight formula_weight	65612.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Entity 38 Entity 38 polymer

Description description	Splicing regulator SDE2
Molecular weight formula_weight	49818.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAELGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK

Entity 39 Entity 39 polymer

Description description	Coiled-coil domain-containing protein 12
Molecular weight formula_weight	19223.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD

Entity 40 Entity 40 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,h

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 41 Entity 41 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,i

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 42 Entity 42 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,j

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 43 Entity 43 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,k

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 44 Entity 44 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,l

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 45 Entity 45 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,m

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 46 Entity 46 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,n

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 47 Entity 47 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 48 Entity 48 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 49 Entity 49 polymer

Description description	Pre-mRNA-processing factor 19
Molecular weight formula_weight	55245.5 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,r,s,t

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL

Entity 50 Entity 50 polymer

Description description	Peptidylprolyl isomerase domain and WD repeat-containing protein 1
Molecular weight formula_weight	73679.9 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MAAESGSDFQQRRRRRRDPEEPEKTELSERELAVAVAVSQENDEENEERWVGPLPVEATLAKKRKVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIEEGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMAATQAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK

Entity 51 Entity 51 polymer

Description description	Splicing factor C9orf78
Molecular weight formula_weight	33751.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEHEEQKVKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYEKFKKMNRRY

Entity 52 Entity 52 polymer

Description description	Peptidyl-prolyl cis-trans isomerase E
Molecular weight formula_weight	33475.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Entity 53 Entity 53 polymer

Description description	NF-kappa-B-activating protein
Molecular weight formula_weight	47252.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGELGAPEVWGLSPKNPEPDSDEHTPVEDEEPKKSTTSASTSEEEKKKKSSRSKERSKKRRKKKSSKRKHKKYSEDSDSDSDSETDSSDEDNKRRAKKAKKKEKKKKHRSKKYKKKRSKKSRKESSDSSSKESQEEFLENPWKDRTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK

Entity 54 Entity 54 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 55 Entity 55 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 56 Entity 56 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 57 Entity 57 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 58 Entity 58 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 59 Entity 59 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	103860

Integrative model of the human post-catalytic spliceosome (P-complex)

1. Protein Identity and Related Structures Protein Identity & Related Structures

PRKR-interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor ESS-2 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein FAM32A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein FAM50A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

STING ER exit protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Eukaryotic initiation factor 4A-III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA-binding protein 8A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein mago nashi homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing-splicing factor 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 200 kDa helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer