8ro2

Integrative Structure of the human intron lariat Spliceosome (ILS'')

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–972； UniProt 1–972

Pre-mRNA-splicing factor ISY1 homolog

OrganismNot specified

UniProt Q9ULR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISY1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–285； UniProt 1–285

ATP-dependent RNA helicase DHX15

OrganismNot specified

UniProt O43143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHX15_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain DX； PDBConstruct 1–795； UniProt 1–795

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–357； UniProt 1–357

Crooked neck-like protein 1

OrganismNot specified

UniProt Q9BZJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRNL1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–848； UniProt 1–848

Pre-mRNA-splicing factor SPF27

OrganismNot specified

UniProt O75934

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPF27_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–225； UniProt 1–225

CWF19-like protein 1

OrganismNot specified

UniProt Q69YN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C19L1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L1； PDBConstruct 1–538； UniProt 1–538

Protein BUD31 homolog

OrganismNot specified

UniProt P41223

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BUD31_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–144； UniProt 1–144

Pre-mRNA-splicing factor RBM22

OrganismNot specified

UniProt Q9NW64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBM22_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–420； UniProt 1–420

Intron-binding protein aquarius

OrganismNot specified

UniProt O60306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AQR_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Q； PDBConstruct 1–1485； UniProt 1–1485

SNW domain-containing protein 1

OrganismNot specified

UniProt Q13573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNW1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain R； PDBConstruct 1–536； UniProt 1–536

Peptidyl-prolyl cis-trans isomerase-like 1

OrganismNot specified

UniProt Q9Y3C6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIL1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain S； PDBConstruct 1–166； UniProt 1–166

Pre-mRNA-processing factor 17

OrganismNot specified

UniProt O60508

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP17_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–579； UniProt 1–579

Coiled-coil domain-containing protein 12

OrganismNot specified

UniProt Q8WUD4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCD12_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Z； PDBConstruct 1–166； UniProt 1–166

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain a； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain c； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain d； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain e； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain g； PDBConstruct 1–76； UniProt 1–76

Pre-mRNA-processing factor 19

OrganismNot specified

UniProt Q9UMS4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP19_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain q； PDBConstruct 1–504； UniProt 1–504 Author chain r； PDBConstruct 1–504； UniProt 1–504 Author chain s； PDBConstruct 1–504； UniProt 1–504 Author chain t； PDBConstruct 1–504； UniProt 1–504

Splicing regulator SDE2

OrganismNot specified

UniProt Q6IQ49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SDE2_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain z； PDBConstruct 1–451； UniProt 1–451

Splicing factor ESS-2 homolog

OrganismNot specified

UniProt Q96DF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ESS2_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 3； PDBConstruct 1–476； UniProt 1–476

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

Pre-mRNA-splicing factor SYF1

OrganismNot specified

UniProt Q9HCS7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYF1_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain I； PDBConstruct 1–855； UniProt 1–855

Cell division cycle 5-like protein

OrganismNot specified

UniProt Q99459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC5L_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain L； PDBConstruct 1–802； UniProt 1–802

CWF19-like protein 2

OrganismNot specified

UniProt Q2TBE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C19L2_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain L2； PDBConstruct 1–894； UniProt 1–894

Pre-mRNA-splicing factor SYF2

OrganismNot specified

UniProt O95926

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYF2_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain M； PDBConstruct 1–243； UniProt 1–243

Spliceosome-associated protein CWC15 homolog

OrganismNot specified

UniProt Q9P013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CWC15_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain P； PDBConstruct 1–229； UniProt 1–229

PAX3- and PAX7-binding protein 1

OrganismNot specified

UniProt Q9Y5B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PAXB1_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain PX； PDBConstruct 1–917； UniProt 1–917

Pleiotropic regulator 1

OrganismNot specified

UniProt O43660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Tuftelin-interacting protein 11 × 1 （Q9UBB9） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLRG1_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain T； PDBConstruct 1–514； UniProt 1–514

Tuftelin-interacting protein 11

OrganismNot specified

UniProt Q9UBB9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFP11_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain TF； PDBConstruct 1–837； UniProt 1–837

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 4	U2 snRNA × 1 U6 snRNA × 1 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Pre-mRNA-splicing factor ISY1 homolog × 1 （Q9ULR0） ATP-dependent RNA helicase DHX15 × 1 （O43143） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Crooked neck-like protein 1 × 1 （Q9BZJ0） Pre-mRNA-splicing factor SPF27 × 1 （O75934） CWF19-like protein 1 × 1 （Q69YN2） Protein BUD31 homolog × 1 （P41223） Pre-mRNA-splicing factor RBM22 × 1 （Q9NW64） Intron-binding protein aquarius × 1 （O60306） SNW domain-containing protein 1 × 1 （Q13573） Peptidyl-prolyl cis-trans isomerase-like 1 × 1 （Q9Y3C6） Pre-mRNA-processing factor 17 × 1 （O60508） Coiled-coil domain-containing protein 12 × 1 （Q8WUD4） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Pre-mRNA-processing factor 19 × 4 （Q9UMS4） Splicing regulator SDE2 × 1 （Q6IQ49） Splicing factor ESS-2 homolog × 1 （Q96DF8） U5 snRNA × 1 Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Pre-mRNA-splicing factor SYF1 × 1 （Q9HCS7） INTRON × 1 Cell division cycle 5-like protein × 1 （Q99459） CWF19-like protein 2 × 1 （Q2TBE0） Pre-mRNA-splicing factor SYF2 × 1 （O95926） Spliceosome-associated protein CWC15 homolog × 1 （Q9P013） PAX3- and PAX7-binding protein 1 × 1 （Q9Y5B6） Pleiotropic regulator 1 × 1 （O43660） Tuftelin-interacting protein 11 × 1 （Q9UBB9） GUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 3 INOSITOL HEXAKISPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain b； PDBConstruct 1–240； UniProt 1–240

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ro2
Deposition date deposition_date	2024-01-11
Structure title title	Integrative Structure of the human intron lariat Spliceosome (ILS'')
Keywords keywords	mRNA, splicing, intron lariat spliceosome, pre-mRNA; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ro2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ro2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ro2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	88.37 Å
Rg (electron density)	87.73 Å
Total Rg	86.88 Å
Atom count	81753
Residues	12024
Excluded volume	1388000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ro2__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	81753

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 2 Entity 2 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Entity 3 Entity 3 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 4 Entity 4 polymer

Description description	Pre-mRNA-splicing factor ISY1 homolog
Molecular weight formula_weight	33046.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY

Entity 5 Entity 5 polymer

Description description	ATP-dependent RNA helicase DHX15
Molecular weight formula_weight	91065.8 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DX

MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY

Entity 6 Entity 6 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 7 Entity 7 polymer

Description description	Crooked neck-like protein 1
Molecular weight formula_weight	100610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCALDALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQVPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPDEDVDESES

Entity 8 Entity 8 polymer

Description description	Pre-mRNA-splicing factor SPF27
Molecular weight formula_weight	26163.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Entity 9 Entity 9 polymer

Description description	CWF19-like protein 1
Molecular weight formula_weight	60696.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1

MAQKPLRLLACGDVEGKFDILFNRVQAIQKKSGNFDLLLCVGNFFGSTQDAEWEEYKTGIKKAPIQTYVLGANNQETVKYFQDADGCELAENITYLGRKGIFTGSSGLQIVYLSGTESLNEPVPGYSFSPKDVSSLRMMLCTTSQFKGVDILLTSPWPKCVGNFGNSSGEVDTKKCGSALVSSLATGLKPRYHFAALEKTYYERLPYRNHIILQENAQHATRFIALANVGNPEKKKYLYAFSIVPMKLMDAAELVKQPPDVTENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSSPHPKQPRKPPQPPGPCWFCLASPEVEKHLVVNIGTHCYLALAKGGLSDDHVLILPIGHYQSVVELSAEVVEEVEKYKATLRRFFKSRGKWCVVFERNYKSHHLQLQVIPVPISCSTTDDIKDAFITQAQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDFTLDD

Entity 10 Entity 10 polymer

Description description	Protein BUD31 homolog
Molecular weight formula_weight	17032.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

Entity 11 Entity 11 polymer

Description description	Pre-mRNA-splicing factor RBM22
Molecular weight formula_weight	46959.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP

Entity 12 Entity 12 polymer

Description description	Intron-binding protein aquarius
Molecular weight formula_weight	171502.5 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFAIRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQLARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSEPVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPDVTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQNLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPSETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK

Entity 13 Entity 13 polymer

Description description	SNW domain-containing protein 1
Molecular weight formula_weight	61770.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Entity 14 Entity 14 polymer

Description description	Peptidyl-prolyl cis-trans isomerase-like 1
Molecular weight formula_weight	18257.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

Entity 15 Entity 15 polymer

Description description	Pre-mRNA-processing factor 17
Molecular weight formula_weight	65612.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Entity 16 Entity 16 polymer

Description description	Coiled-coil domain-containing protein 12
Molecular weight formula_weight	19223.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD

Entity 17 Entity 17 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 18 Entity 18 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 20 Entity 20 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 21 Entity 21 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 22 Entity 22 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 23 Entity 23 polymer

Description description	Pre-mRNA-processing factor 19
Molecular weight formula_weight	55245.5 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s,q,r,t

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL

Entity 24 Entity 24 polymer

Description description	Splicing regulator SDE2
Molecular weight formula_weight	49818.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAELGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK

Entity 25 Entity 25 polymer

Description description	Splicing factor ESS-2 homolog
Molecular weight formula_weight	52640.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

METPGASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDVFLSRYTSEDNASFQEIMEVAKERSRARHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQASVETWKYKAKNSLMYYPEGVPDEEQLFKKPRQVVHKNTRFLRDPFSQALSRCQLQQAAALNAQHKQGKVGPDGKELIPQESPRVGGFGFVATPSPAPGVNESPMMTWGEVENTPLRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF

Entity 26 Entity 26 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGCCUUGCCUUGGCAAGGCUA

Entity 27 Entity 27 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 28 Entity 28 polymer

Description description	Pre-mRNA-splicing factor SYF1
Molecular weight formula_weight	100148.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRVYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED

Entity 29 Entity 29 polymer

Description description	INTRON
Molecular weight formula_weight	30153.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	IN

NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN

Entity 30 Entity 30 polymer

Description description	Cell division cycle 5-like protein
Molecular weight formula_weight	92406.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Entity 31 Entity 31 polymer

Description description	CWF19-like protein 2
Molecular weight formula_weight	103976.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L2

MATSMAAASGRFESAKSIEERKEQTRNARAEVLRQAKANFEKEERRKELKRLRGEDTWMLPDVNERIEQFSQEHSVKKKKKKDKHSKKAKKEKKKKSKKQKYEKNNESSDSSSSSEDEWVEAVPSQTPDKEKAWKVKDEKSGKDDTQIIKRDEWMTVDFMSVKTVSSSSLKAEKETMRKIEQEKNQALEQSKLMERELNPYWKDGGTGLPPEDCSVSSITKVSVVEDGGLSWLRKSYLRMKEQAEKQSRNFEDIVAERYGSMEIFQSKLEDAEKAASTKEDYRRERWRKPTYSDKAQNCQESRESDLVKYGNSSRDRYATTDTAKNSNNEKFIGDEKDKRPGSLETCRRESNPRQNQEFSFGNLRAKFLRPSDDEELSFHSKGRKFEPLSSSSALVAQGSLCSGFRKPTKNSEERLTSWSRSDGRGDKKHSNQKPSETSTDEHQHVPEDPREKSQDEVLRDDPPKKEHLRDTKSTFAGSPERESIHILSVDEKNKLGAKIIKAEMMGNMELAEQLKVQLEKANKFKETITQIPKKSGVENEDQQEVILVRTDQSGRVWPVNTPGKSLESQGGRRKRQMVSTHEERERVRYFHDDDNLSLNDLVKNEKMGTAENQNKLFMRMASKFMGKTDGDYYTLDDMFVSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYCFDSSQFPKHLIVAIGVKVYLCLPNVRSLTEGHCLIVPLQHHRAATLLDEDIWEEIQMFRKSLVKMFEDKGLDCIFLETNMSMKKQYHMVYECIPLPKEVGDMAPIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFSVDFGLHGGFAHVIEDQHKFPHYFGKEIIGGMLDIEPRLWRKGIRESFEDQRKKALQFAQWWKPYDFTKSKNY

Entity 32 Entity 32 polymer

Description description	Pre-mRNA-splicing factor SYF2
Molecular weight formula_weight	28780.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV

Entity 33 Entity 33 polymer

Description description	Spliceosome-associated protein CWC15 homolog
Molecular weight formula_weight	26674.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Entity 34 Entity 34 polymer

Description description	PAX3- and PAX7-binding protein 1
Molecular weight formula_weight	104953.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	PX

MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPPPGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPGLGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRASLLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYKEDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQEDGVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSSYGIPYSYTAYGSSDAKSQKTDNTVPFKTPSNEMTPVTIDLVKKQLKDRLDSMKELHKTNRQQHEKHLQSRVDSTRAIERLEGSSGGIGERYKFLQEMRGYVQDLLECFSEKVPLINELESAIHQLYKQRASRLVQRRQDDIKDESSEFSSHSNKALMAPNLDSFGRDRALYQEHAKRRIAEREARRTRRRQAREQTGKMADHLEGLSSDDEETSTDITNFNLEKDRISKESGKVFEDVLESFYSIDCIKSQFEAWRSKYYTSYKDAYIGLCLPKLFNPLIRLQLLTWTPLEAKCRDFENMLWFESLLFYGCEEREQEKDDVDVALLPTIVEKVILPKLTVIAENMWDPFSTTQTSRMVGITLKLINGYPSVVNAENKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQRQFWSSVKLLGNFLQWYGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIKKAQNVINCFPKQWFMNLKGERTISQLENFCRYLVHLADTIYRNSIGCSDVEKRNARENIKQIVKLLASVRALDHAMSVASDHNVKEFKSLIEGK

Entity 35 Entity 35 polymer

Description description	Pleiotropic regulator 1
Molecular weight formula_weight	57280.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF

Entity 36 Entity 36 polymer

Description description	Tuftelin-interacting protein 11
Molecular weight formula_weight	96945.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	TF

MSLSHLYRDGEGRIDDDDDERENFEITDWDLQNEFNPNRQRHWQTKEEATYGVWAERDSDDERPSFGGKRARDYSAPVNFISAGLKKGAAEEAELEDSDDEEKPVKQDDFPKDFGPRKLKTGGNFKPSQKGFAGGTKSFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSERTTQSMQDFPVVDSEEEAEEEFQKELSQWRKDPSGSKKKPKYSYKTVEELKAKGRISKKLTAPQKELSQVKVIDMTGREQKVYYSYSQISHKHNVPDDGLPLQSQQLPQSGKEAKAPGFALPELEHNLQLLIDLTEQEIIQNDRQLQYERDMVVNLFHELEKMTEVLDHEERVISNLSKVLEMVEECERRMQPDCSNPLTLDECARIFETLQDKYYEEYRMSDRVDLAVAIVYPLMKEYFKEWDPLKDCTYGTEIISKWKSLLENDQLLSHGGQDLSADAFHRLIWEVWMPFVRNIVTQWQPRNCDPMVDFLDSWVHIIPVWILDNILDQLIFPKLQKEVENWNPLTDTVPIHSWIHPWLPLMQARLEPLYSPIRSKLSSALQKWHPSDSSAKLILQPWKDVFTPGSWEAFMVKNIVPKLGMCLGELVINPHQQHMDAFYWVIDWEGMISVSSLVGLLEKHFFPKWLQVLCSWLSNSPNYEEITKWYLGWKSMFSDQVLAHPSVKDKFNEALDIMNRAVSSNVGAYMQPGARENIAYLTHTERRKDFQYEAMQERREAENMAQRGIGVAASSVPMNFKDLIETKAEEHNIVFMPVIGKRHEGKQLYTFGRIVIYIDRGVVFVQGEKTWVPTSLQSLIDMAK

Entity 37 Entity 37 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 38 Entity 38 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 39 Entity 39 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 40 Entity 40 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	87951

Integrative Structure of the human intron lariat Spliceosome (ILS'')

1. Protein Identity and Related Structures Protein Identity & Related Structures

116 kDa U5 small nuclear ribonucleoprotein component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor ISY1 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent RNA helicase DHX15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Crooked neck-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor SPF27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CWF19-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein BUD31 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor RBM22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intron-binding protein aquarius

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer