SAXSdb — 4xdn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAU2 chromatid cohesion factor homolog

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Sister chromatid cohesion protein 2 × 1 （Q04002） SULFATE ION × 5 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCC4_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 20–643； UniProt 1–624

Sister chromatid cohesion protein 2

Saccharomyces cerevisiae

UniProt Q04002

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MAU2 chromatid cohesion factor homolog × 1 （P40090） SULFATE ION × 5 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCC2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 20–200； UniProt 1–181

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4xdn
Deposition date deposition_date	2014-12-19
Structure title title	Crystal structure of Scc4 in complex with Scc2n
Keywords keywords	cohesion, centromere, cohesin loading, CELL CYCLE; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4xdn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4xdn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4xdn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.06 Å
Rg (electron density)	31.49 Å
Total Rg	32.01 Å
Atom count	5888
Residues	726
Excluded volume	105800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4xdn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MAU2 chromatid cohesion factor homolog
Molecular weight formula_weight	74557.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6189

MKSSHHHHHHENLYFQSNAMENLGDKLSISQVYHLAQEYRDHAYSIANKIGSEEGLKQYYGLMNMSIQMFQLLKTKCTLSVLEDSKVTFEMVELLIQETYNFDLAELYISSLKERLQTHQSDTDLVEEIMRCEFLLLHDLPLMRDSKFHYKIALRNCNELVQYMVNLQDELYQNWASVFQYVGVMLCIKLKQHRRVKTSFHGLLSQCREKSQWKWFLNLCYVNYLLNERFPIPEDALQELRSTELHTVGPELYAWKLALEMVIQLCKDGNITDHLNEFKNFFDTNKQSLVTNEGKGCVIKIMPRIALKVELPMIFHYKELKNILLLLQSVSYIVNCYDEKGNFSRKFLPKVYSTTQKLIKNIAAGGVSMNELDSRIQTYKSILEFCEFYKVWEQTLLKGAVVTTESPKLGPSPGYVRLLQAMKVQFEGGGAVEEYTRLAQSGGTSSEVKMISLLNCYTVQAARVSRCSGDKQGELVEQCNKVWLQVEKLLQETDLQFNPIWECTVTILWLFSHFEPFSWNPLPCSDKQRAEYVSKLREFYSSNKFVAGEAVADNRFKLKKALLLQILVNYLGGRMLEHDLGEIYAISAKCFDMCRQQGGMRKVQYVIGIWHLMNCTVAMRGKDVALTNAKLEALVKQITSVKQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Sister chromatid cohesion protein 2
Molecular weight formula_weight	21868.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKSSHHHHHHENLYFQSNAMSYPGKDKNIPGRIIEALEDLPLSYLVPKDGLAALVNAPMRVSLPFDKTIFTSADDGRDVNINVLGTANSTTSSIKNEAEKERLVFKRPSNFTSSANSVDYVPTNFLEGLSPLAQSVLSTHKGLNDSINIEKKSEIVSRPEAKHKLESVTSNAGNLSFNDNSSNKKTKTSTGVTMTQANLA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	301

▶

Unit-cell length a length_a	51.579 Å
Unit-cell length b length_b	177.279 Å
Unit-cell length c length_c	51.343 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	111.11 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.080 Å
Low-resolution limit resolution_low	28.720 Å
R factor r_factor	0.1860
R_work r_work	0.1850
R_free r_free	0.2100

Crystal structure of Scc4 in complex with Scc2n

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAU2 chromatid cohesion factor homolog

State in the Current Structure

Other States of the Same Protein in the Database

Sister chromatid cohesion protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4xdn__assembly_1__model_1

4xdn__assembly_1__model_1 | I(q)

4xdn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of Scc4 in complex with Scc2n

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAU2 chromatid cohesion factor homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sister chromatid cohesion protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4xdn__assembly_1__model_1

4xdn__assembly_1__model_1 | I(q)

4xdn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)