SAXSdb — 4z9g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	OLEIC ACID × 3 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1 SULFATE ION × 2	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	OLEIC ACID × 3 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	OLEIC ACID × 4 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1 SULFATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C3V2B5_BPR51
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 119–278； UniProt 2–161 Author chain B； PDBConstruct 119–278； UniProt 2–161 Author chain C； PDBConstruct 119–278； UniProt 2–161

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

Homo sapiens

UniProt P34998

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	OLEIC ACID × 3 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1 SULFATE ION × 2	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	OLEIC ACID × 3 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	OLEIC ACID × 4 3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine × 1 SULFATE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRFR1_HUMAN
Isoform	P34998-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–118； UniProt 103–220 Author chain A； PDBConstruct 280–429； UniProt 252–401 Author chain B； PDBConstruct 1–118； UniProt 103–220 Author chain B； PDBConstruct 280–429； UniProt 252–401 Author chain C； PDBConstruct 1–118； UniProt 103–220 Author chain C； PDBConstruct 280–429； UniProt 252–401

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4z9g
Deposition date deposition_date	2015-04-10
Structure title title	Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395 in a hexagonal setting with translational non-crystallographic symmetry
Keywords keywords	7TM, GPCR, FAMILY B, SIGNALING PROTEIN, G-PROTEIN, MEMBRANE, MEMBRANE PROTEIN, RECEPTOR, tNCS, HEXAGONAL; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4z9g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4z9g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4z9g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.72 Å
Rg (electron density)	27.77 Å
Total Rg	28.50 Å
Atom count	3467
Residues	421
Excluded volume	63037 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4z9g__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4z9g__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4z9g__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1
Molecular weight formula_weight	50643.9 kDa
EC 编号 ec_number	3.2.1.17
Mutation mutation	;V120A, L144A, W156A, S160A, N1040S, A1041V, C1054S, C1097S, T1151A, S222L, K228A, F260A, I277A, Y309A, F330A, S349A, Y363A,V120A, L144A, W156A, S160A, N1040S, A1041V, C1054S, C1097S, T1151A, S222L, K228A, F260A, I277A, Y309A, F330A, S349A, Y363A,V120A, L144A, W156A, S160A, N1040S, A1041V, C1054S, C1097S, T1151A, S222L, K228A, F260A, I277A, Y309A, F330A, S349A, Y363A ;
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	10244

MEILNEEKKSKVHYHVAAIINYLGHCISLVALLVAFVLFLRARSIRCLRNIIHANLIAAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLSVAKSELDKAIGRNSNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRSALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVIATFRTGTWDAYLTDRLRAWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWAGKRPGVYTDYIYQGPMALVLLINFIFLFNIVRILMTKLRASTTSETIQARKAVKATLVLLPLLGITYMLAFVNPGEDEVSRVVFIYFNAFLESFQGFFVSVFACFLNSEVRSAAAAHHHHHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 non-polymer

Description description	OLEIC ACID
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 3 Entity 3 non-polymer

Description description	3,6-dimethyl-N-(pentan-3-yl)-2-(2,4,6-trimethylphenoxy)pyridin-4-amine
Molecular weight formula_weight	326.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	189.359 Å
Unit-cell length b length_b	189.359 Å
Unit-cell length c length_c	88.575 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 6
Space-group number int_tables_number	168
Crystal system crystal_system	—

Resolution resolution	3.183 Å
Low-resolution limit resolution_low	19.910 Å
R factor r_factor	0.2467
R_work r_work	0.2444
R_free r_free	0.2886

Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395 in a hexagonal setting with translational non-crystallographic symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4z9g__assembly_1__model_1

4z9g__assembly_1__model_1 | I(q)

4z9g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)

Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395 in a hexagonal setting with translational non-crystallographic symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Corticotropin-releasing factor receptor 1,Lysozyme,Corticotropin-releasing factor receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4z9g__assembly_1__model_1

4z9g__assembly_1__model_1 | I(q)

4z9g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)