SAXSdb — 5b5v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MOB kinase activator 1B

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–216 Chain C； UniProt 1–216 Chain E； UniProt 1–216 Chain F； UniProt 1–216	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, Ammonium fluoride	Resolution 2.19 Å R-free 0.246
2	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–216 Chain D； UniProt 1–216	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, Ammonium fluoride	Resolution 2.19 Å R-free 0.246

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5B5V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B5W Crystal structure of MOB1-LATS1 NTR domain complex Deposited 2016-05-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 33–216（184 aa） Fragment：UNP residues 33-216	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG 4000	Resolution 2.96 Å R-free 0.270
5B6B Complex of LATS1 and phosphomimetic MOB1b Deposited 2016-05-26	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–216（216 aa） Chain B 1–216（216 aa）	Mutation：T35D, T22D Mutation：T35D, T22D	CL CHLORIDE ION × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, sodium sulfate	Resolution 3.54 Å R-free 0.266
5B6B Complex of LATS1 and phosphomimetic MOB1b Deposited 2016-05-26	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–216（216 aa） Chain K 1–216（216 aa）	Mutation：T35D, T22D Mutation：T35D, T22D	CL CHLORIDE ION × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, sodium sulfate	Resolution 3.54 Å R-free 0.266
5B6B Complex of LATS1 and phosphomimetic MOB1b Deposited 2016-05-26	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 1–216（216 aa） Chain H 1–216（216 aa）	Mutation：T35D, T22D Mutation：T35D, T22D	CL CHLORIDE ION × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, sodium sulfate	Resolution 3.54 Å R-free 0.266
5B6B Complex of LATS1 and phosphomimetic MOB1b Deposited 2016-05-26	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain M 1–216（216 aa） Chain O 1–216（216 aa）	Mutation：T35D, T22D Mutation：T35D, T22D	CL CHLORIDE ION × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG 3350, sodium sulfate	Resolution 3.54 Å R-free 0.266

2 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MOB1B_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–218； UniProt 1–216 Author chain B； PDBConstruct 3–218； UniProt 1–216 Author chain C； PDBConstruct 3–218； UniProt 1–216 Author chain D； PDBConstruct 3–218； UniProt 1–216 Author chain E； PDBConstruct 3–218； UniProt 1–216 Author chain F； PDBConstruct 3–218； UniProt 1–216

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5b5v
Deposition date deposition_date	2016-05-24
Structure title title	Structure of full-length MOB1b
Keywords keywords	MOB1 Hippo pathway, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	32.80 Å
Radius of gyration Rg (electron density) rg_electron	32.28 Å
Forward intensity I(0) i0	115064000.00
Molecular weight molecular_weight	87678.0 kDa
Excluded volume excluded_volume	110330 Å³
Envelope volume envelope_volume	140280 Å³
Hydration-shell volume shell_volume	37090 Å³
Envelope diameter envelope_diameter	108.9 Å
Shell Rg shell_rg	38.29 Å
Envelope Rg envelope_rg	32.07 Å
Shape Rg shape_rg	32.26 Å
Total Rg total_rg	32.87 Å
Total atoms total_atoms	6176
Residues n_residues	752
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	106.6 Å
Rg (real space) rg_real	32.88 Å
Rg uncertainty (real space) rg_real_error	0.70 Å
I(0) (real space) i0_real	1.1510e+08
I(0) uncertainty (real space) i0_real_error	1.6730e+06
Rg (reciprocal space) rg_reciprocal	32.86 Å
I(0) (reciprocal space) i0_reciprocal	115100000.0000
Solution quality estimate total_estimate	0.8914
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	33.3 Å
Skewness Skewness skewness	0.330
Kurtosis Kurtosis kurtosis	-0.592
Angular range angular_range	— – 0.2400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	24690000.0000
Real-space data points n_real_points	49
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.909; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.941; Smooth: 0.916

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MOB kinase activator 1B
Molecular weight formula_weight	25277.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	6325

GPMSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d5b5va_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d5b5vb_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d5b5vc_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d5b5vd_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d5b5ve_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d5b5vf_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

CATH v4.4 (4 domains)

Domain ID domain_id	5b5vA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

Domain ID domain_id	5b5vB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

Domain ID domain_id	5b5vC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

Domain ID domain_id	5b5vD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

▶

8. Citations (1)

▶

Unit-cell length a length_a	59.355 Å
Unit-cell length b length_b	127.686 Å
Unit-cell length c length_c	59.294 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.03 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.193 Å
Low-resolution limit resolution_low	29.673 Å
R factor r_factor	0.2340
R_work r_work	0.2333
R_free r_free	0.2463

fit	/app/data/saxs_computation/b5/5b5v/5b5v.fit
pddf	/app/data/pr_computation/b5/5b5v/5b5v.pr.out
profile	/app/data/saxs_computation/b5/5b5v/5b5v.dat

Structure of full-length MOB1b

1. Protein Identity and Related Structures Protein Identity & Related Structures

MOB kinase activator 1B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction