SAXSdb — 5cmn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat transmembrane protein FLRT3

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Latrophilin-3 × 1 （Q9HAR2） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Latrophilin-3 × 1 （Q9HAR2） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Latrophilin-3 × 1 （Q9HAR2） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Latrophilin-3 × 1 （Q9HAR2） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLRT3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–333； UniProt 29–357 Author chain B； PDBConstruct 5–333； UniProt 29–357 Author chain C； PDBConstruct 5–333； UniProt 29–357 Author chain D； PDBConstruct 5–333； UniProt 29–357

Latrophilin-3

Homo sapiens

UniProt Q9HAR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Leucine-rich repeat transmembrane protein FLRT3 × 1 （Q9NZU0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Leucine-rich repeat transmembrane protein FLRT3 × 1 （Q9NZU0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Leucine-rich repeat transmembrane protein FLRT3 × 1 （Q9NZU0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Leucine-rich repeat transmembrane protein FLRT3 × 1 （Q9NZU0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LPHN3_HUMAN
Isoform	Q9HAR2-4
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–261； UniProt 132–392 Author chain F； PDBConstruct 1–261； UniProt 132–392 Author chain G； PDBConstruct 1–261； UniProt 132–392 Author chain H； PDBConstruct 1–261； UniProt 132–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5cmn
Deposition date deposition_date	2015-07-17
Structure title title	FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain
Keywords keywords	LRR repeats, Cell Adhesion-Carbohydrate Binding complex, ADGRL3; Cell Adhesion/Carbohydrate Binding
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5cmn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5cmn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5cmn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.57 Å
Rg (electron density)	25.66 Å
Total Rg	26.62 Å
Atom count	4605
Residues	568
Excluded volume	81819 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5cmn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5cmn__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5cmn__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5cmn__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Leucine-rich repeat transmembrane protein FLRT3
Molecular weight formula_weight	37962.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	18420

ADPGKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Latrophilin-3
Molecular weight formula_weight	30009.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

VFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	5cmnA00
Class class	3 — Alpha Beta
Architecture architecture	80 — Alpha-Beta Horseshoe
Topology topology	10 — Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Homologous superfamily homologous superfamily	10 — Ribonuclease Inhibitor

Domain ID domain_id	5cmnB00
Class class	3 — Alpha Beta
Architecture architecture	80 — Alpha-Beta Horseshoe
Topology topology	10 — Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Homologous superfamily homologous superfamily	10 — Ribonuclease Inhibitor

Domain ID domain_id	5cmnC00
Class class	3 — Alpha Beta
Architecture architecture	80 — Alpha-Beta Horseshoe
Topology topology	10 — Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Homologous superfamily homologous superfamily	10 — Ribonuclease Inhibitor

Domain ID domain_id	5cmnD00
Class class	3 — Alpha Beta
Architecture architecture	80 — Alpha-Beta Horseshoe
Topology topology	10 — Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Homologous superfamily homologous superfamily	10 — Ribonuclease Inhibitor

▶

Unit-cell length a length_a	102.268 Å
Unit-cell length b length_b	102.268 Å
Unit-cell length c length_c	419.230 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	3.605 Å
Low-resolution limit resolution_low	73.196 Å
R factor r_factor	0.1987
R_work r_work	0.1950
R_free r_free	0.2618

FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat transmembrane protein FLRT3

State in the Current Structure

Other States of the Same Protein in the Database

Latrophilin-3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5cmn__assembly_1__model_1

5cmn__assembly_1__model_1 | I(q)

5cmn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat transmembrane protein FLRT3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Latrophilin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5cmn__assembly_1__model_1

5cmn__assembly_1__model_1 | I(q)

5cmn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)