SAXSdb — 5cze

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PaaA2

Escherichia coli O157:H7 str. SS52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Plasmid stabilization protein ParE × 8 （A0A0D7C2L1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F6F6Q9_ECO57
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–71； UniProt 14–75 Author chain C； PDBConstruct 10–71； UniProt 14–75 Author chain I； PDBConstruct 10–71； UniProt 14–75 Author chain K； PDBConstruct 10–71； UniProt 14–75

Plasmid stabilization protein ParE

Escherichia coli O157:H7 str. SS52

UniProt A0A0D7C2L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	PaaA2 × 8 （A0A0F6F6Q9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D7C2L1_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–92； UniProt 1–92 Author chain D； PDBConstruct 1–92； UniProt 1–92 Author chain J； PDBConstruct 1–92； UniProt 1–92 Author chain L； PDBConstruct 1–92； UniProt 1–92

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5cze
Deposition date deposition_date	2015-07-31
Structure title title	Crystal structure of the PaaA2-ParE2 antitoxin-toxin complex
Keywords keywords	toxin-antitoxin, toxin; TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5cze__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5cze__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5cze__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.64 Å
Rg (electron density)	32.43 Å
Total Rg	33.08 Å
Atom count	9986
Residues	1204
Excluded volume	177500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5cze__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	PaaA2
Molecular weight formula_weight	8661.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,I,K
Atom count atom_count	4999

MDYKDDDDKNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ

Source Source

Source organism organism	Escherichia coli O157:H7 str. SS52
NCBI taxonomy ID ncbi_taxonomy_id	1330457
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Plasmid stabilization protein ParE
Molecular weight formula_weight	11791.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,J,L

MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVEVVNVIHARRQFPLEHHHHHH

Source Source

Source organism organism	Escherichia coli O157:H7 str. SS52
NCBI taxonomy ID ncbi_taxonomy_id	1330457
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	5czeB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2310 — YaeB-like fold
Homologous superfamily homologous superfamily	20 — RelE-like

Domain ID domain_id	5czeD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2310 — YaeB-like fold
Homologous superfamily homologous superfamily	20 — RelE-like

Domain ID domain_id	5czeJ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2310 — YaeB-like fold
Homologous superfamily homologous superfamily	20 — RelE-like

Domain ID domain_id	5czeL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2310 — YaeB-like fold
Homologous superfamily homologous superfamily	20 — RelE-like

▶

Unit-cell length a length_a	143.226 Å
Unit-cell length b length_b	143.226 Å
Unit-cell length c length_c	86.630 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	3.820 Å
Low-resolution limit resolution_low	46.880 Å
R factor r_factor	0.2560
R_work r_work	0.2530
R_free r_free	0.3060

Crystal structure of the PaaA2-ParE2 antitoxin-toxin complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

PaaA2

State in the Current Structure

Other States of the Same Protein in the Database

Plasmid stabilization protein ParE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5cze__assembly_1__model_1

5cze__assembly_1__model_1 | I(q)

5cze__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the PaaA2-ParE2 antitoxin-toxin complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

PaaA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Plasmid stabilization protein ParE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5cze__assembly_1__model_1

5cze__assembly_1__model_1 | I(q)

5cze__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)