SAXSdb — 5f7t

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

Macaca mulatta

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SYS_THET2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 72–101； UniProt 49–78 Author chain F； PDBConstruct 72–101； UniProt 49–78 Author chain H； PDBConstruct 72–101； UniProt 49–78 Author chain L； PDBConstruct 72–101； UniProt 49–78

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

Macaca mulatta

UniProt Q0PF16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	ZINC ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRIM5_MACMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–71； UniProt 89–159 Author chain E； PDBConstruct 102–141； UniProt 226–265 Author chain F； PDBConstruct 1–71； UniProt 89–159 Author chain F； PDBConstruct 102–141； UniProt 226–265 Author chain H； PDBConstruct 1–71； UniProt 89–159 Author chain H； PDBConstruct 102–141； UniProt 226–265 Author chain L； PDBConstruct 1–71； UniProt 89–159 Author chain L； PDBConstruct 102–141； UniProt 226–265

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5f7t
Deposition date deposition_date	2015-12-08
Structure title title	TRIM5 B-box2 and coiled-coil chimera
Keywords keywords	tripartite motif, HIV, viral restriction, TRIM, E3 ligase, self-assembly, LIGASE; LIGASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5f7t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5f7t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5f7t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.76 Å
Rg (electron density)	20.79 Å
Total Rg	21.25 Å
Atom count	2127
Residues	134
Excluded volume	19003 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5f7t__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5f7t__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5f7t__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5f7t__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5
Molecular weight formula_weight	16474.9 kDa
EC 编号 ec_number	6.3.2.-,6.1.1.11
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,H,L
Atom count atom_count	8557

EEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAETERNQVAKRVPKAPPEEKEALIARGKALGEQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLK

Source Source

Source organism organism	Macaca mulatta
Common name common_name	Rhesus macaque
NCBI taxonomy ID ncbi_taxonomy_id	9544
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	52

▶

Unit-cell length a length_a	45.802 Å
Unit-cell length b length_b	52.329 Å
Unit-cell length c length_c	69.691 Å
Unit-cell angle α angle_alpha	94.77 °
Unit-cell angle β angle_beta	105.54 °
Unit-cell angle γ angle_gamma	103.02 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.292 Å
Low-resolution limit resolution_low	35.052 Å
R factor r_factor	0.2254
R_work r_work	0.2237
R_free r_free	0.2564

TRIM5 B-box2 and coiled-coil chimera

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5f7t__assembly_1__model_1

5f7t__assembly_1__model_1 | I(q)

5f7t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

TRIM5 B-box2 and coiled-coil chimera

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tripartite motif-containing protein 5,Serine--tRNA ligase,Tripartite motif-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5f7t__assembly_1__model_1

5f7t__assembly_1__model_1 | I(q)

5f7t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)