SAXSdb — 5fq7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BT_2263

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	BT_2264 × 2 （Q8A5H5） BT_2261 × 2 （Q8A5H8） BT_2262 × 2 （Q8A5H7） PEPTIDE × 2 MAGNESIUM ION × 2 SODIUM ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8A5H6_BACTN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–480； UniProt 19–498 Author chain C； PDBConstruct 1–480； UniProt 19–498

BT_2264

OrganismNot specified

UniProt Q8A5H5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	BT_2263 × 2 （Q8A5H6） BT_2261 × 2 （Q8A5H8） BT_2262 × 2 （Q8A5H7） PEPTIDE × 2 MAGNESIUM ION × 2 SODIUM ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8A5H5_BACTN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–984； UniProt 1–984 Author chain D； PDBConstruct 1–984； UniProt 1–984

BT_2261

OrganismNot specified

UniProt Q8A5H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	BT_2263 × 2 （Q8A5H6） BT_2264 × 2 （Q8A5H5） BT_2262 × 2 （Q8A5H7） PEPTIDE × 2 MAGNESIUM ION × 2 SODIUM ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8A5H8_BACTN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–148； UniProt 19–166 Author chain F； PDBConstruct 1–148； UniProt 19–166

BT_2262

OrganismNot specified

UniProt Q8A5H7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	BT_2263 × 2 （Q8A5H6） BT_2264 × 2 （Q8A5H5） BT_2261 × 2 （Q8A5H8） PEPTIDE × 2 MAGNESIUM ION × 2 SODIUM ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8A5H7_BACTN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–212； UniProt 19–230 Author chain H； PDBConstruct 1–212； UniProt 19–230

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5fq7
Deposition date deposition_date	2015-12-07
Structure title title	Crystal structure of the SusCD complex BT2261-2264 from Bacteroides thetaiotaomicron
Keywords keywords	MEMBRANE PROTEIN, SUGAR BINDING PROTEIN, OUTER MEMBRANE NUTRIENT IMPORTER SUSCD COMPLEX; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5fq7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5fq7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5fq7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.08 Å
Rg (electron density)	48.14 Å
Total Rg	48.35 Å
Atom count	25886
Residues	3329
Excluded volume	456280 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5fq7__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	BT_2263
Molecular weight formula_weight	53145.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	25886

CDLNINDDPNYPMNDQVTADLIFPSISASIASAVGGEIYNYAGFFAQYYEQKPESNQYNTLCEYTFTESSQQMDYSYRILFAGALEDAKQVLEKTTNPADRFATTILRAYAFQIMVDNTSDSPYSEALQGNANATPKWDTGETVYKGILGEIDAAEAALDGSGMDVPDLIFNKNIAQWKGFANALRLRMYLRFIDANIDAASYTEKVKTLVQNNEFFTGDVKLDCFLDETDKRNPWYNTNAVGLTGNHCAAYPLVSYLSSTGDPRIAYGISKTDADGKYVGQLPGGKTHMQSILGTDNWKNKNVSAIDYSIGATKPVYFFTQAELQFLIAEVYARFHNDDANAKSAYEAGVTADFAVRGFAGQENTILEGACAWSAASTQADKLNLIYMQKWVSLFYMDHMEAWSEIRRTDCPKLSSYSAAQIQASESVYTPGELVAPWTNGLEAGGLMKRMTYPLSARQQNVNTPAGVPGSTPVWWDIK

Entity 2 Entity 2 polymer

Description description	BT_2264
Molecular weight formula_weight	108954.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MQTQEVAIKPNLKVVLRSDAQQIDEVVVTAMGIKRSEKALGYAATSVGGEKIAESRTSDVMSSLAGKIAGVQISSTSSDPGASNSVIIRGVSSLSGTNQPLYVVDGVPLNNSTVYSTDGLNSGYDFGNGANAINPDDVANMTILKGAAATALYGSRAANGVVMITTKSGRKEKGVGIEYNGGVQWSTVLRLPEFQNEFGMGWNGNHTELENGSWGPRFDGSMQLWGNVYNNSQKLKPYVAMPDNIKDFFDAGFRYSNSLSFNGATDKSDYYVSFSQISDDGMIPTDADSYDKYTFSARGSHKAGALTFSSSLNYAYQKNNFATTGQGLSMLNSLYQTPRDISIIGLEDQNDPFNTPGYYYTPYGVMNPYYILNNYLNEYESERFYGKFQLDYEFLKYFKFTYRMGLDTTTGQSDKGKPNLYALYYEGTPNGEGQGSSSPFSGETGQYSEQITRRREINQDIMVNFNMPVNDFNINALVGFNGNERKVSYQYSEVNDLTIPTWFNLKNSGKTPIVEQHMELRRLMGVFGQFEGSWKNMLYLTVTARNDWSSTLPKENRSFFYPGITGSFIFSELLNDNLQDVITFGKIRASWGKTGNDADVYMVNPVYAQSSNRIPFGSLTFPLGGVNAYSAGNVLGSNTLSPEMTTESEVGLNMAFFKNRLSFDVSYYNRNTDKQIFSLAMDPASGYTAQNMNLGKIRNRGIELLISGTPIRTKDFSWELTWNFTKNWSKVISLPEELGGITTIYGLNGGTSMYAITGMPVGVFKAQVAERDPQGRIVVNSSTGLPVEASEFGICGDMNNKYQMGVSTNLKYKGISLGIDFDIRQGGVMYSRTKDINYFTGNAIQTAYNDRNPLIVPNSVNKIVNGENVTYVENTTPITSSNIYKYWGDGGSDMGSCFLVDKSYVKLRSVVLGWDLPKRWLAKTPFQAVKVSAYGNNLFVWTPSSNTFIDPEMTSFGNDLEGNYGEYTANPSSRRFGFNLMVKF

Entity 3 Entity 3 polymer

Description description	BT_2261
Molecular weight formula_weight	16429.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

CDNDTEPGGTAVEKMAGDWWVTVNAFIDGKEVEDPFGAGHLQMSTYNTASNSETEMWLDDLGNFWEYKLKVNVNYAARTFSTTGFVDNVTYESKVKITDGKVLEKAATTPSGMPADSIVYMVQFDDDEDGLTYKVSGFRRTGFPADDF

Entity 4 Entity 4 polymer

Description description	BT_2262
Molecular weight formula_weight	23399.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

CDKSTDDTSKVTYFVTLEREGDEKIVLEKGQPFVEPGYYAEMNGEDITESVQIKGSVDVNTPGIYNLVYAAYNEDGFAKTFTRTVYVADNTASPLKSGIYTVAEGSKRTAPSVVAFSGYEIVIFQMEPGIFYISDFLGGWYDQRAGYGPDYAMVGKFELNDDNTITPLESYVAGWGDSMDQMTNTLLDPATGTLKWTVAYAGQLSFDIIVKQ

Entity 5 Entity 5 polymer

Description description	PEPTIDE
Molecular weight formula_weight	588.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,P

GGGGGGGGGG

Entity 6 Entity 6 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	5fq7A00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	390 —

Domain ID domain_id	5fq7C00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	390 —

Domain ID domain_id	5fq7E00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	220 —

Domain ID domain_id	5fq7F00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	220 —

▶

Unit-cell length a length_a	123.591 Å
Unit-cell length b length_b	180.159 Å
Unit-cell length c length_c	245.747 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	48.432 Å
R factor r_factor	0.2060
R_work r_work	0.2006
R_free r_free	0.2554

Crystal structure of the SusCD complex BT2261-2264 from Bacteroides thetaiotaomicron

1. Protein Identity and Related Structures Protein Identity & Related Structures

BT_2263

State in the Current Structure

Other States of the Same Protein in the Database

BT_2264

State in the Current Structure

Other States of the Same Protein in the Database

BT_2261

State in the Current Structure

Other States of the Same Protein in the Database

BT_2262

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5fq7__assembly_1__model_1

5fq7__assembly_1__model_1 | I(q)

5fq7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the SusCD complex BT2261-2264 from Bacteroides thetaiotaomicron

1. Protein Identity and Related Structures Protein Identity & Related Structures

BT_2263

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BT_2264

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BT_2261

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BT_2262

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5fq7__assembly_1__model_1

5fq7__assembly_1__model_1 | I(q)

5fq7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)