SAXSdb — 5ica

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative uncharacterized protein × 1 （G0SG95） Putative U3 snoRNP protein × 1 （G0S872） Periodic tryptophan protein 2-like protein × 1 （G0SF93）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZL9_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–163； UniProt 769–931

Putative uncharacterized protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0SG95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative uncharacterized protein × 1 （G0RZL9） Putative U3 snoRNP protein × 1 （G0S872） Periodic tryptophan protein 2-like protein × 1 （G0SF93）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SG95_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–152； UniProt 738–889

Putative U3 snoRNP protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S872

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative uncharacterized protein × 1 （G0RZL9） Putative uncharacterized protein × 1 （G0SG95） Periodic tryptophan protein 2-like protein × 1 （G0SF93）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S872_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–244； UniProt 806–1049

Periodic tryptophan protein 2-like protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0SF93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative uncharacterized protein × 1 （G0RZL9） Putative uncharacterized protein × 1 （G0SG95） Putative U3 snoRNP protein × 1 （G0S872）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SF93_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–149； UniProt 701–849

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ica
Deposition date deposition_date	2016-02-23
Structure title title	Structure of the CTD complex of UTP12, Utp13, Utp1 and Utp21
Keywords keywords	rRNA processing, 90S preribosome, protein binding, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5ica__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5ica__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5ica__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.17 Å
Rg (electron density)	27.46 Å
Total Rg	28.27 Å
Atom count	4377
Residues	548
Excluded volume	78549 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5ica__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	18434.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4377

TKQTVETLMAGERIAEALELGMTDLNTIREWEEARQINPNIAPPQRNPIFVALGNIPAETYVLNTLQKIKPASLHDALLVLPFSTIPSLLTFLNLFAQRELNVPLTCRILFFVLKTHHKQIVASRTMRATLEKVRANLRAALRRQKDEMGFNIAALKVVSMQL

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	17371.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

LVEQEQTLENYIHAGAYRDAIVLALQLNHPGRLLNLFTNVVTTRNPDPDSLTGLKAVDDVLAKLSDEQIFQLLLRLRDWNTNARTAPVAQRVLWALFKSHPANKLSSLSVKGARGHKSLNEVLDAIKVYTERHYKRIEELVDESYLVEYTLR

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Putative U3 snoRNP protein
Molecular weight formula_weight	27202.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

EGGQGLIEAALEAEEEQAEDDGVMAPIIDQLSADMMTLSLVPRSRWQTLLHIDIIKARNKPKEPPKAPEKAPFFLPPVGQNGISSLIPQEDAKAKKEKAAANGASRITKLDLTRQEQTFTSKLLVGGAKGDYTDFIEHLKALPPAAADLELRSLSIGNGDEATNELLHFIRALTSRLVARRDYELTQAWMTVFLRLHFDLIMENEELLQALGEWREHQARERDRLSELVGYCGGVVSFLRSPRT

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Periodic tryptophan protein 2-like protein
Molecular weight formula_weight	17158.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

DNTVQFDPFDLNMEITPASTLAVLEKEKDYLKALVMAFRLNEAGLITRVYQAIPYTDIGLVVEQFPTVYVPRLLRFVAAQTEQSPHMEFCLLWIRALIDKHGPWLAANRGKVDVELRVVARAVAKMRDEIRRLADENVYMVDYLLNQAK

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	121.695 Å
Unit-cell length b length_b	121.695 Å
Unit-cell length c length_c	167.490 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	3.507 Å
Low-resolution limit resolution_low	34.382 Å
R factor r_factor	0.2470
R_work r_work	0.2438
R_free r_free	0.2750

Structure of the CTD complex of UTP12, Utp13, Utp1 and Utp21

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative U3 snoRNP protein

State in the Current Structure

Other States of the Same Protein in the Database

Periodic tryptophan protein 2-like protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ica__assembly_1__model_1

5ica__assembly_1__model_1 | I(q)

5ica__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the CTD complex of UTP12, Utp13, Utp1 and Utp21

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative U3 snoRNP protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Periodic tryptophan protein 2-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ica__assembly_1__model_1

5ica__assembly_1__model_1 | I(q)

5ica__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)