5l4k

The human 26S proteasome lid

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome non-ATPase regulatory subunit 4

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain W； PDBConstruct 1–377； UniProt 1–377

26S proteasome non-ATPase regulatory subunit 14

OrganismNot specified

UniProt O00487

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSDE_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain V； PDBConstruct 1–310； UniProt 1–310

26S proteasome non-ATPase regulatory subunit 8

OrganismNot specified

UniProt P48556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain T； PDBConstruct 1–350； UniProt 1–350

26S proteasome complex subunit DSS1

OrganismNot specified

UniProt P60896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSS1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Y； PDBConstruct 1–70； UniProt 1–70

26S proteasome non-ATPase regulatory subunit 2

OrganismNot specified

UniProt Q13200

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Z； PDBConstruct 1–908； UniProt 1–908

26S proteasome non-ATPase regulatory subunit 1

OrganismNot specified

UniProt Q99460

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain N； PDBConstruct 1–953； UniProt 1–953

26S proteasome non-ATPase regulatory subunit 3

OrganismNot specified

UniProt O43242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD3_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–534； UniProt 1–534

26S proteasome non-ATPase regulatory subunit 12

OrganismNot specified

UniProt O00232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD12_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain P； PDBConstruct 1–456； UniProt 1–456

26S proteasome non-ATPase regulatory subunit 11

OrganismNot specified

UniProt O00231

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD11_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 1–422； UniProt 1–422

26S proteasome non-ATPase regulatory subunit 6

OrganismNot specified

UniProt Q15008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD6_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain R； PDBConstruct 1–389； UniProt 1–389

26S proteasome non-ATPase regulatory subunit 7

OrganismNot specified

UniProt P51665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD7_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain U； PDBConstruct 1–324； UniProt 1–324

26S proteasome non-ATPase regulatory subunit 13

OrganismNot specified

UniProt Q9UNM6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 1 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit DSS1 × 1 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q13200） 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD13_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–376； UniProt 1–376

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5l4k
Deposition date deposition_date	2016-05-25
Structure title title	The human 26S proteasome lid
Keywords keywords	proteostasis, AAA-ATPase, structural protein; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5l4k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5l4k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5l4k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.15 Å
Rg (electron density)	72.91 Å
Total Rg	72.97 Å
Atom count	79649
Residues	5000
Excluded volume	709600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5l4k__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	26S proteasome non-ATPase regulatory subunit 4
Molecular weight formula_weight	40781.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W
Atom count atom_count	79649

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK

Entity 2 Entity 2 polymer

Description description	26S proteasome non-ATPase regulatory subunit 14
Molecular weight formula_weight	34620.0 kDa
EC 编号 ec_number	3.4.19.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Entity 3 Entity 3 polymer

Description description	26S proteasome non-ATPase regulatory subunit 8
Molecular weight formula_weight	39667.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Entity 4 Entity 4 polymer

Description description	26S proteasome complex subunit DSS1
Molecular weight formula_weight	8284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Entity 5 Entity 5 polymer

Description description	26S proteasome non-ATPase regulatory subunit 2
Molecular weight formula_weight	100313.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

Entity 6 Entity 6 polymer

Description description	26S proteasome non-ATPase regulatory subunit 1
Molecular weight formula_weight	105958.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD

Entity 7 Entity 7 polymer

Description description	26S proteasome non-ATPase regulatory subunit 3
Molecular weight formula_weight	61066.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Entity 8 Entity 8 polymer

Description description	26S proteasome non-ATPase regulatory subunit 12
Molecular weight formula_weight	52979.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

Entity 9 Entity 9 polymer

Description description	26S proteasome non-ATPase regulatory subunit 11
Molecular weight formula_weight	47526.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT

Entity 10 Entity 10 polymer

Description description	26S proteasome non-ATPase regulatory subunit 6
Molecular weight formula_weight	45592.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Entity 11 Entity 11 polymer

Description description	26S proteasome non-ATPase regulatory subunit 7
Molecular weight formula_weight	37086.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK

Entity 12 Entity 12 polymer

Description description	26S proteasome non-ATPase regulatory subunit 13
Molecular weight formula_weight	42995.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDILT

▼

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d5l4kw_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.900 Å
Low-resolution limit resolution_low	3.900 Å
R factor r_factor	0.4025
R_work r_work	0.4025
R_free r_free	0.4039

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	461402

The human 26S proteasome lid

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome non-ATPase regulatory subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome complex subunit DSS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer