5t0c

Structural basis for dynamic regulation of the human 26S proteasome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome non-ATPase regulatory subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AU； PDBConstruct 1–953； UniProt 1–953 Author chain BU； PDBConstruct 1–953； UniProt 1–953

26S proteasome non-ATPase regulatory subunit 3

OrganismNot specified

UniProt O43242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AV； PDBConstruct 1–533； UniProt 2–534 Author chain BV； PDBConstruct 1–533； UniProt 2–534

26S proteasome non-ATPase regulatory subunit 12

OrganismNot specified

UniProt O00232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD12_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AW； PDBConstruct 1–456； UniProt 1–456 Author chain BW； PDBConstruct 1–456； UniProt 1–456

26S proteasome non-ATPase regulatory subunit 11

OrganismNot specified

UniProt O00231

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD11_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AX； PDBConstruct 1–422； UniProt 1–422 Author chain BX； PDBConstruct 1–422； UniProt 1–422

26S proteasome non-ATPase regulatory subunit 6

OrganismNot specified

UniProt Q15008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AY； PDBConstruct 1–389； UniProt 1–389 Author chain BY； PDBConstruct 1–389； UniProt 1–389

26S proteasome non-ATPase regulatory subunit 7

OrganismNot specified

UniProt P51665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD7_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–324； UniProt 1–324 Author chain BZ； PDBConstruct 1–324； UniProt 1–324

26S proteasome non-ATPase regulatory subunit 13

OrganismNot specified

UniProt Q9UNM6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD13_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–376； UniProt 1–376 Author chain Ba； PDBConstruct 1–376； UniProt 1–376

26S proteasome non-ATPase regulatory subunit 4

OrganismNot specified

UniProt P55036

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD4_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–377； UniProt 1–377 Author chain Bb； PDBConstruct 1–377； UniProt 1–377

26S proteasome non-ATPase regulatory subunit 14

OrganismNot specified

UniProt O00487

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSDE_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–310； UniProt 1–310 Author chain Bc； PDBConstruct 1–310； UniProt 1–310

26S proteasome non-ATPase regulatory subunit 8

OrganismNot specified

UniProt P48556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD8_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–257； UniProt 94–350 Author chain Bd； PDBConstruct 1–257； UniProt 94–350

26S proteasome complex subunit DSS1

OrganismNot specified

UniProt P60896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSS1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–70； UniProt 1–70 Author chain Be； PDBConstruct 1–70； UniProt 1–70

26S proteasome non-ATPase regulatory subunit 2

OrganismNot specified

UniProt Q13200

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Af； PDBConstruct 1–908； UniProt 1–908 Author chain Bf； PDBConstruct 1–908； UniProt 1–908

26S protease regulatory subunit 7

OrganismNot specified

UniProt P35998

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AA； PDBConstruct 1–433； UniProt 1–433 Author chain BA； PDBConstruct 1–433； UniProt 1–433

26S protease regulatory subunit 4

OrganismNot specified

UniProt P62191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AB； PDBConstruct 1–440； UniProt 1–440 Author chain BB； PDBConstruct 1–440； UniProt 1–440

26S protease regulatory subunit 6B

OrganismNot specified

UniProt P43686

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AD； PDBConstruct 1–418； UniProt 1–418 Author chain BD； PDBConstruct 1–418； UniProt 1–418

26S protease regulatory subunit 10B

OrganismNot specified

UniProt P62333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AE； PDBConstruct 1–389； UniProt 1–389 Author chain BE； PDBConstruct 1–389； UniProt 1–389

26S protease regulatory subunit 6A

OrganismNot specified

UniProt P17980

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AF； PDBConstruct 1–439； UniProt 1–439 Author chain BF； PDBConstruct 1–439； UniProt 1–439

26S protease regulatory subunit 8

OrganismNot specified

UniProt P62195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AC； PDBConstruct 1–406； UniProt 1–406 Author chain BC； PDBConstruct 1–406； UniProt 1–406

Proteasome subunit alpha type-6

OrganismNot specified

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain AG； PDBConstruct 1–245； UniProt 2–246 Author chain BG； PDBConstruct 1–245； UniProt 2–246

Proteasome subunit alpha type-2

OrganismNot specified

UniProt P25787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain AH； PDBConstruct 1–233； UniProt 2–234 Author chain BH； PDBConstruct 1–233； UniProt 2–234

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain AI； PDBConstruct 1–260； UniProt 2–261 Author chain BI； PDBConstruct 1–260； UniProt 2–261

Proteasome subunit alpha type-7

OrganismNot specified

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–247； UniProt 2–248 Author chain BJ； PDBConstruct 1–247； UniProt 2–248

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain AK； PDBConstruct 1–240； UniProt 2–241 Author chain BK； PDBConstruct 1–240； UniProt 2–241

Proteasome subunit alpha type-1

OrganismNot specified

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	P25786-2
PDB entities	24
Chains and sequence ranges	Author chain AL； PDBConstruct 1–268； UniProt 2–269 Author chain BL； PDBConstruct 1–268； UniProt 2–269

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain AM； PDBConstruct 1–254； UniProt 2–255 Author chain BM； PDBConstruct 1–254； UniProt 2–255

Proteasome subunit beta type-6

OrganismNot specified

UniProt P28072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain AN； PDBConstruct 1–238； UniProt 2–239 Author chain BN； PDBConstruct 1–238； UniProt 2–239

Proteasome subunit beta type-7

OrganismNot specified

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain AO； PDBConstruct 1–276； UniProt 2–277 Author chain BO； PDBConstruct 1–276； UniProt 2–277

Proteasome subunit beta type-3

OrganismNot specified

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain AP； PDBConstruct 1–204； UniProt 2–205 Author chain BP； PDBConstruct 1–204； UniProt 2–205

Proteasome subunit beta type-2

OrganismNot specified

UniProt P49721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–201； UniProt 1–201 Author chain BQ； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-5

OrganismNot specified

UniProt P28074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain AR； PDBConstruct 1–262； UniProt 2–263 Author chain BR； PDBConstruct 1–262； UniProt 2–263

Proteasome subunit beta type-1

OrganismNot specified

UniProt P20618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-4 × 2 （P28070） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain AS； PDBConstruct 1–240； UniProt 2–241 Author chain BS； PDBConstruct 1–240； UniProt 2–241

Proteasome subunit beta type-4

OrganismNot specified

UniProt P28070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 64	26S proteasome non-ATPase regulatory subunit 1 × 2 （Q99460） 26S proteasome non-ATPase regulatory subunit 3 × 2 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 2 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 2 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 2 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 2 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 2 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 2 （P55036） 26S proteasome non-ATPase regulatory subunit 14 × 2 （O00487） 26S proteasome non-ATPase regulatory subunit 8 × 2 （P48556） 26S proteasome complex subunit DSS1 × 2 （P60896） 26S proteasome non-ATPase regulatory subunit 2 × 2 （Q13200） 26S protease regulatory subunit 7 × 2 （P35998） 26S protease regulatory subunit 4 × 2 （P62191） 26S protease regulatory subunit 6B × 2 （P43686） 26S protease regulatory subunit 10B × 2 （P62333） 26S protease regulatory subunit 6A × 2 （P17980） 26S protease regulatory subunit 8 × 2 （P62195） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） ZINC ION × 2 ADENOSINE-5'-TRIPHOSPHATE × 8 ADENOSINE-5'-DIPHOSPHATE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain AT； PDBConstruct 1–263； UniProt 2–264 Author chain BT； PDBConstruct 1–263； UniProt 2–264

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5t0c
Deposition date deposition_date	2016-08-15
Structure title title	Structural basis for dynamic regulation of the human 26S proteasome
Keywords keywords	ubiquitin-proteasome system, AAA-ATPase, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5t0c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5t0c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5t0c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	135.90 Å
Total Rg	135.60 Å
Atom count	155574
Residues	19846
Excluded volume	2777600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5t0c__assembly_1__model_1`	64-meric （64）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	26S proteasome non-ATPase regulatory subunit 1
Molecular weight formula_weight	105958.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU,BU
Atom count atom_count	155574

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD

Entity 2 Entity 2 polymer

Description description	26S proteasome non-ATPase regulatory subunit 3
Molecular weight formula_weight	60935.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV,BV

KQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Entity 3 Entity 3 polymer

Description description	26S proteasome non-ATPase regulatory subunit 12
Molecular weight formula_weight	52979.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW,BW

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

Entity 4 Entity 4 polymer

Description description	26S proteasome non-ATPase regulatory subunit 11
Molecular weight formula_weight	47526.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX,BX

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT

Entity 5 Entity 5 polymer

Description description	26S proteasome non-ATPase regulatory subunit 6
Molecular weight formula_weight	45592.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY,BY

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Entity 6 Entity 6 polymer

Description description	26S proteasome non-ATPase regulatory subunit 7
Molecular weight formula_weight	37086.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ,BZ

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK

Entity 7 Entity 7 polymer

Description description	26S proteasome non-ATPase regulatory subunit 13
Molecular weight formula_weight	42995.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ba

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDILT

Entity 8 Entity 8 polymer

Description description	26S proteasome non-ATPase regulatory subunit 4
Molecular weight formula_weight	40781.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab,Bb

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK

Entity 9 Entity 9 polymer

Description description	26S proteasome non-ATPase regulatory subunit 14
Molecular weight formula_weight	34620.0 kDa
EC 编号 ec_number	3.4.19.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac,Bc

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Entity 10 Entity 10 polymer

Description description	26S proteasome non-ATPase regulatory subunit 8
Molecular weight formula_weight	30039.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad,Bd

MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Entity 11 Entity 11 polymer

Description description	26S proteasome complex subunit DSS1
Molecular weight formula_weight	8284.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae,Be

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Entity 12 Entity 12 polymer

Description description	26S proteasome non-ATPase regulatory subunit 2
Molecular weight formula_weight	100313.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af,Bf

MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

Entity 13 Entity 13 polymer

Description description	26S protease regulatory subunit 7
Molecular weight formula_weight	48700.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,BA

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN

Entity 14 Entity 14 polymer

Description description	26S protease regulatory subunit 4
Molecular weight formula_weight	49260.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,BB

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

Entity 15 Entity 15 polymer

Description description	26S protease regulatory subunit 6B
Molecular weight formula_weight	47426.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD,BD

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Entity 16 Entity 16 polymer

Description description	26S protease regulatory subunit 10B
Molecular weight formula_weight	44241.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,BE

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

Entity 17 Entity 17 polymer

Description description	26S protease regulatory subunit 6A
Molecular weight formula_weight	49266.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,BF

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA

Entity 18 Entity 18 polymer

Description description	26S protease regulatory subunit 8
Molecular weight formula_weight	45694.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,BC

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

Entity 19 Entity 19 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27301.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,BG

SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 20 Entity 20 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25796.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,BH

AERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Entity 21 Entity 21 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29394.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,BI

SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

Entity 22 Entity 22 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27798.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,BJ

SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 23 Entity 23 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26304.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,BK

FLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 24 Entity 24 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	30150.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL,BL

QLSKVKFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Entity 25 Entity 25 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28338.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM,BM

SSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Entity 26 Entity 26 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	25246.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN,BN

AATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA

Entity 27 Entity 27 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	29869.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO,BO

AAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Entity 28 Entity 28 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22841.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP,BP

SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Entity 29 Entity 29 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22864.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ,BQ

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Entity 30 Entity 30 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	28379.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR,BR

ALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP

Entity 31 Entity 31 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	26391.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,BS

LSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Entity 32 Entity 32 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	29100.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT,BT

EAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Entity 33 Entity 33 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 35 Entity 35 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	86420

Structural basis for dynamic regulation of the human 26S proteasome

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome non-ATPase regulatory subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer