5le5

Native human 20S proteasome at 1.8 Angstrom

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234 Author chain O； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–261； UniProt 1–261 Author chain P； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

OrganismNot specified

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–248； UniProt 1–248 Author chain Q； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 1–241 Author chain R； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-1

OrganismNot specified

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–263； UniProt 1–263 Author chain S； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–255； UniProt 1–255 Author chain T； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit alpha type-6

OrganismNot specified

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–246； UniProt 1–246 Author chain U； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit beta type-7

OrganismNot specified

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–234； UniProt 44–277 Author chain V； PDBConstruct 1–234； UniProt 44–277

Proteasome subunit beta type-3

OrganismNot specified

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–205； UniProt 1–205 Author chain W； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-2

OrganismNot specified

UniProt P49721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–201； UniProt 1–201 Author chain X； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-5

OrganismNot specified

UniProt P28074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–204； UniProt 60–263 Author chain Y； PDBConstruct 1–204； UniProt 60–263

Proteasome subunit beta type-1

OrganismNot specified

UniProt P20618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–213； UniProt 29–241 Author chain Z； PDBConstruct 1–213； UniProt 29–241

Proteasome subunit beta type-4

OrganismNot specified

UniProt P28070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-6 × 2 （P28072） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–219； UniProt 46–264 Author chain a； PDBConstruct 1–219； UniProt 46–264

Proteasome subunit beta type-6

OrganismNot specified

UniProt P28072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） CHLORIDE ION × 57 PENTAETHYLENE GLYCOL × 9 POTASSIUM ION × 6 MAGNESIUM ION × 10 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–205； UniProt 35–239 Author chain b； PDBConstruct 1–205； UniProt 35–239

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5le5
Deposition date deposition_date	2016-06-29
Structure title title	Native human 20S proteasome at 1.8 Angstrom
Keywords keywords	Proteasome, Multicatalytic Proteinase, NTN-Hydrolase, hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5le5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5le5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5le5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.03 Å
Rg (electron density)	59.63 Å
Total Rg	59.72 Å
Atom count	48407
Residues	6213
Excluded volume	863960 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5le5__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25927.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O
Atom count atom_count	52161

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29525.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27986.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26436.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29720.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28469.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27739.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	25322.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22972.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22989.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	22484.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y

TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	23579.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z

RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	24414.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a

TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	21921.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b

TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA

Entity 15 Entity 15 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	57

Entity 16 Entity 16 non-polymer

Description description	PENTAETHYLENE GLYCOL
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 17 Entity 17 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 19 Entity 19 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3512

▼

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (26 domains)

Domain ID domain_id	d5le5a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5e_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5f_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5g_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5h_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5i_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5j_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5k_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5l_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5m_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5n_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5o_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5p_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5q_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5r_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5s_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5t_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5u_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5v_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5w_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d5le5x_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5y_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d5le5z_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

CATH v4.4 (28 domains)

Domain ID domain_id	5le5A00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5B00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5C00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5D00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5E00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5F00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5G00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5H00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5I00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5J00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5K00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5L00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5M00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5N00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5O00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5P00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5Q00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5R00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5S00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5T00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5U00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5V00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5W00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5X00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5Y00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5Z00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5a00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	5le5b00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

▶

Unit-cell length a length_a	113.440 Å
Unit-cell length b length_b	202.770 Å
Unit-cell length c length_c	316.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	170.660 Å
R factor r_factor	0.1836
R_work r_work	0.1821
R_free r_free	0.2117

Native human 20S proteasome at 1.8 Angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer