5lnk

Entire ovine respiratory complex I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial complex I, 51 kDa subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PUX0_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–445； UniProt 20–464

Mitochondrial complex I, 24 kDa subunit

OrganismNot specified

UniProt W5NRY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NRY1_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–217； UniProt 30–246

Mitochondrial complex I, 75 kDa subunit

OrganismNot specified

UniProt W5QB34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QB34_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–704； UniProt 24–727

Mitochondrial complex I, 49 kDa subunit

OrganismNot specified

UniProt W5PJ73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PJ73_SHEEP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–412； UniProt 1–412

Mitochondrial complex I, 30 kDa subunit

OrganismNot specified

UniProt W5PB27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PB27_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 5； PDBConstruct 1–228； UniProt 39–266

Mitochondrial complex I, ND1 subunit

OrganismNot specified

UniProt O78747

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_SHEEP
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–318； UniProt 1–318

Mitochondrial complex I, ND2 subunit

OrganismNot specified

UniProt O78748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_SHEEP
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain N； PDBConstruct 1–347； UniProt 1–347

Mitochondrial complex I, ND3 subunit

OrganismNot specified

UniProt O78753

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–115； UniProt 1–115

Mitochondrial complex I, ND4 subunit

OrganismNot specified

UniProt O78755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_SHEEP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–459； UniProt 1–459

Mitochondrial complex I, ND4L subunit

OrganismNot specified

UniProt O78754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_SHEEP
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–98； UniProt 1–98

Mitochondrial complex I, ND5 subunit

OrganismNot specified

UniProt O78756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_SHEEP
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–599； UniProt 1–599

Mitochondrial complex I, ND6 subunit

OrganismNot specified

UniProt O78757

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_SHEEP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–175； UniProt 1–175

Mitochondrial complex I, 39 kDa subunit

OrganismNot specified

UniProt W5PI58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PI58_SHEEP
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain d； PDBConstruct 1–338； UniProt 36–373

Mitochondrial complex I, B8 subunit

OrganismNot specified

UniProt W5QAH8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QAH8_SHEEP
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain e； PDBConstruct 1–98； UniProt 2–99

Mitochondrial complex I, B13 subunit

OrganismNot specified

UniProt W5PNX7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PNX7_SHEEP
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain f； PDBConstruct 1–115； UniProt 2–116

Mitochondrial complex I, B14 subunit

OrganismNot specified

UniProt W5QC06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QC06_SHEEP
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain g； PDBConstruct 1–127； UniProt 14–140

Mitochondrial complex I, B14.5a subunit

OrganismNot specified

UniProt W5P0I2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P0I2_SHEEP
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain h； PDBConstruct 1–112； UniProt 3–114

Mitochondrial complex I, B17.2 subunit

OrganismNot specified

UniProt B9VGZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B9VGZ9_SHEEP
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain i； PDBConstruct 1–145； UniProt 1–145

Acyl carrier protein

OrganismNot specified

UniProt W5NQT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NQT7_SHEEP
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain X； PDBConstruct 1–88； UniProt 70–157 Author chain j； PDBConstruct 1–88； UniProt 70–157

Mitochondrial complex I, 42 kDa subunit

OrganismNot specified

UniProt W5QBF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QBF5_SHEEP
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain k； PDBConstruct 1–320； UniProt 36–355

Mitochondrial complex I, B9 subunit

OrganismNot specified

UniProt W5NYM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NYM7_SHEEP
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain m； PDBConstruct 1–83； UniProt 2–84

Mitochondrial complex I, B12 subunit

OrganismNot specified

UniProt W5Q5T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q5T4_SHEEP
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain n； PDBConstruct 1–97； UniProt 2–98

Mitochondrial complex I, B17 subunit

OrganismNot specified

UniProt W5PZE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PZE3_SHEEP
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain r； PDBConstruct 1–127； UniProt 2–128

Mitochondrial complex I, B18 subunit

OrganismNot specified

UniProt W5P5V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P5V3_SHEEP
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain s； PDBConstruct 1–136； UniProt 2–137

Mitochondrial complex I, B22 subunit

OrganismNot specified

UniProt W5PGA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PGA3_SHEEP
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain t； PDBConstruct 1–178； UniProt 2–179

Mitochondrial complex I, AGGG subunit

OrganismNot specified

UniProt W5PVD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PVD7_SHEEP
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain u； PDBConstruct 1–72； UniProt 37–108

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt W5Q1B0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q1B0_SHEEP
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain v； PDBConstruct 1–158； UniProt 29–186

Mitochondrial complex I, ESSS subunit

OrganismNot specified

UniProt W5PWF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PWF1_SHEEP
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain w； PDBConstruct 1–125； UniProt 30–154

Mitochondrial complex I, PGIV subunit

OrganismNot specified

UniProt W5PYA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, SGDH subunit × 1 （W5QHN8） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PYA5_SHEEP
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain Y； PDBConstruct 1–171； UniProt 2–172

Mitochondrial complex I, SGDH subunit

OrganismNot specified

UniProt W5QHN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Mitochondrial complex I, 51 kDa subunit × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 75 kDa subunit × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 （W5PJ73） Mitochondrial complex I, 30 kDa subunit × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, ND1 subunit × 1 （O78747） Mitochondrial complex I, ND2 subunit × 1 （O78748） Mitochondrial complex I, ND3 subunit × 1 （O78753） Mitochondrial complex I, ND4 subunit × 1 （O78755） Mitochondrial complex I, ND4L subunit × 1 （O78754） Mitochondrial complex I, ND5 subunit × 1 （O78756） Mitochondrial complex I, ND6 subunit × 1 （O78757） Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 Mitochondrial complex I, 18 kDa subunit × 1 Mitochondrial complex I, 39 kDa subunit × 1 （W5PI58） Mitochondrial complex I, B8 subunit × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14 subunit × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Mitochondrial complex I, B17.2 subunit × 1 （B9VGZ9） Acyl carrier protein × 2 （W5NQT7） Mitochondrial complex I, 42 kDa subunit × 1 （W5QBF5） Mitochondrial complex I, 15 kDa subunit × 1 Mitochondrial complex I, B9 subunit × 1 （W5NYM7） Mitochondrial complex I, B12 subunit × 1 （W5Q5T4） Mitochondrial complex I, B14.5b subunit × 1 Mitochondrial complex I, B15 subunit × 1 Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） Mitochondrial complex I, B18 subunit × 1 （W5P5V3） Mitochondrial complex I, B22 subunit × 1 （W5PGA3） Mitochondrial complex I, AGGG subunit × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, PDSW subunit × 1 Mitochondrial complex I, PGIV subunit × 1 （W5PYA5） Mitochondrial complex I, B14.7 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CARDIOLIPIN × 4 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QHN8_SHEEP
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain W； PDBConstruct 1–143； UniProt 47–189

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5lnk
Deposition date deposition_date	2016-08-04
Structure title title	Entire ovine respiratory complex I
Keywords keywords	NADH:ubiquinone, oxidoreductase, complex I, mammalian, mitochondrial; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5lnk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5lnk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5lnk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	82.12 Å
Rg (electron density)	82.43 Å
Total Rg	82.26 Å
Atom count	63760
Residues	8037
Excluded volume	1145900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5lnk__assembly_1__model_1`	45-meric （45）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (54)

Entity 1 Entity 1 polymer

Description description	Mitochondrial complex I, 51 kDa subunit
Molecular weight formula_weight	48678.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	63760

FSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Entity 2 Entity 2 polymer

Description description	Mitochondrial complex I, 24 kDa subunit
Molecular weight formula_weight	23840.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

GAGGALFVHRDTPKNNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 3 Entity 3 polymer

Description description	Mitochondrial complex I, 75 kDa subunit
Molecular weight formula_weight	77031.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

TATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTHTTWEDALSRVAGMLQSCQGNDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLQEAKKPMVVLGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCVTRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVMPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAHAVEEPSIC

Entity 4 Entity 4 polymer

Description description	Mitochondrial complex I, 49 kDa subunit
Molecular weight formula_weight	47120.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 5 Entity 5 polymer

Description description	Mitochondrial complex I, 30 kDa subunit
Molecular weight formula_weight	26441.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

ESASADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFSELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPVESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPEAK

Entity 6 Entity 6 polymer

Description description	Mitochondrial complex I, PSST subunit
Molecular weight formula_weight	20104.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

PSSTQPAVSQARAVVPKPAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR

Entity 7 Entity 7 polymer

Description description	Mitochondrial complex I, TYKY subunit
Molecular weight formula_weight	20219.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 8 Entity 8 polymer

Description description	Mitochondrial complex I, ND1 subunit
Molecular weight formula_weight	35884.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MFMINVLTLIIPILLAVAFLTLVERKVLGYMQFRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHNPYMPELYTINFTIKSLLLSITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT

Entity 9 Entity 9 polymer

Description description	Mitochondrial complex I, ND2 subunit
Molecular weight formula_weight	39149.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNPIILIIILMTVMLGTIIVMISTHWLLIWIGFEMNMLAIIPIMMKKHNPRATEASTKYFLTQSTASMLLMMAIIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQILPSINLDLILTLSILSITIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLLYNPTMTLLNLIIYIIMTSTMFTLFMANSTTTTLSLSHTWNKAPIMTILVLITLLSMGGLPPLSGFMPKWMIIQEMTKNDSIILPTLMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPTTKRMTLLPTMTVLSTMLLPLTPILSILE

Entity 10 Entity 10 polymer

Description description	Mitochondrial complex I, ND3 subunit
Molecular weight formula_weight	13106.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE

Entity 11 Entity 11 polymer

Description description	Mitochondrial complex I, ND4 subunit
Molecular weight formula_weight	52058.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLKYIIPTMMLMPLTWLSKNSMIWINTTLHSLLISLTSLLLLNQFGDNSLNFSLTFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLARKKLFISMLILLQLFLIMTFTATELIFFYIMFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTMGSLNFLILQYWVQPMPNSWSNTFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMMRITLLLNPITDFMAYPFIMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERVHSRTMILARGLQTLLPLMAAWWLLASLTNLALPPSINLIGELFVVMSTFSWSNITIILMGLNMVITALYSLYMLITTQRGKHTHHINNILPSFTRENALMSLHMLPLLLLSLNPKIILGPLY

Entity 12 Entity 12 polymer

Description description	Mitochondrial complex I, ND4L subunit
Molecular weight formula_weight	10840.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC

Entity 13 Entity 13 polymer

Description description	Mitochondrial complex I, ND5 subunit
Molecular weight formula_weight	67554.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MNLFSSLTLVTLILLTMPIAAINFNTHKFTNYPLYVKTTISCAFITSMIPTMMFIHTGQEMIISNWHWLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLINLNTWDLQQIFMLNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKFGQSIMLCLGAMTTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGGLFKAMPFTTTALIIGSLALTGMPFLTGFYSKDLIIESANTSYTNAWALLMTLVATSFTAIYSTRIIFFALLGQPRFPTLININENNPFLINSIKRLLIGSLFAGFIISNNIPPMTIPQMTMPHYLKMTALTVTILGFILALEISNTTHYLKFNYPSNTFKFSNLLGYYPTIMHRLTPYMNLTMSQKSASSLLDLIWLETILPKTISLAQMKMSTTITSQKGLIKLYFLSFLITILIST

Entity 14 Entity 14 polymer

Description description	Mitochondrial complex I, ND6 subunit
Molecular weight formula_weight	19126.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

Entity 15 Entity 15 polymer

Description description	Mitochondrial complex I, 10 kDa subunit
Molecular weight formula_weight	8423.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

SAESGKNEKGLPPNPKKQSPPKKPASAAPTEPFDNTTYKNLQHHDYSTYTFLDLNLDLSKFRMPQPSSGRESPRH

Entity 16 Entity 16 polymer

Description description	Mitochondrial complex I, 13 kDa subunit
Molecular weight formula_weight	10651.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

GVRTSPTGEKVTHTGQVYDDEDYRRVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQHH

Entity 17 Entity 17 polymer

Description description	Mitochondrial complex I, 18 kDa subunit
Molecular weight formula_weight	15375.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

AQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAIAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 18 Entity 18 polymer

Description description	Mitochondrial complex I, 39 kDa subunit
Molecular weight formula_weight	38660.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

LHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRNKAVGEKEVRETFPEATIIKPADIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPNRYLLFDLVQYVFAVAHRPFLPYPMPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDRTLPHLPGLEDLGVQATPLELKAIEVLRRHRTYRWLSSEIEDVQPAK

Entity 19 Entity 19 polymer

Description description	Mitochondrial complex I, B8 subunit
Molecular weight formula_weight	10966.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

AAAAAIRGVRGKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSSKA

Entity 20 Entity 20 polymer

Description description	Mitochondrial complex I, B13 subunit
Molecular weight formula_weight	13156.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

AGLLKKTTGLVGLAVCETPHERLKILYTKILDVLGHIPKNAAYRKYTEQITNEKLSIVKAEPDVKKLEEQLQGGQIEEVILQAENELSLARKMIQWKPWEPLVEEPPASQWKWPI

Entity 21 Entity 21 polymer

Description description	Mitochondrial complex I, B14 subunit
Molecular weight formula_weight	14923.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

AASGLRQAAVAASTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDISVKQGRDKVREMFKKNAHVTDPRVVDLLVIKGKMELEETINVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 22 Entity 22 polymer

Description description	Mitochondrial complex I, B14.5a subunit
Molecular weight formula_weight	12399.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

ASATRLIQGLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHRLSNNYYCARDGRREAMPPSIVMSSQKVLVAGKPAESSAVAASEKKAVSPAPPIKRWELSQDEPYL

Entity 23 Entity 23 polymer

Description description	Mitochondrial complex I, B17.2 subunit
Molecular weight formula_weight	17115.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MELLQVLKRGLQQVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTVKPPTARKFIWTNHKFNLSGTPQQYVPYSTTRKKIQEWVPPSTPYK

Entity 24 Entity 24 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	10119.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,X

SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 25 Entity 25 polymer

Description description	Mitochondrial complex I, 42 kDa subunit
Molecular weight formula_weight	36803.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

LQYGPLAYILGEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGIHYADSTTGDGKPLPVRFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFIRKQCVDHYNQVKKVTVCEYLPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTFLPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQDDRKLHNLRMLVQDKLEVLNYTSIPVFLPEVTIGAHQSDRVFQEFTELPGRKYRAGYNEDVGDKWIWLK

Entity 26 Entity 26 polymer

Description description	Mitochondrial complex I, 15 kDa subunit
Molecular weight formula_weight	12474.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

PFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP

Entity 27 Entity 27 polymer

Description description	Mitochondrial complex I, B9 subunit
Molecular weight formula_weight	9194.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

APRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL

Entity 28 Entity 28 polymer

Description description	Mitochondrial complex I, B12 subunit
Molecular weight formula_weight	11015.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

AHGHGHEHGPSKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAVGAEYYLESQKKDKKHH

Entity 29 Entity 29 polymer

Description description	Mitochondrial complex I, B14.5b subunit
Molecular weight formula_weight	14231.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MMTGRQARAPLQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSAGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYREVFEEFHPVR

Entity 30 Entity 30 polymer

Description description	Mitochondrial complex I, B15 subunit
Molecular weight formula_weight	14976.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

SFPKYEPSRLASLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYNDPSRRGVVEDPALIRWTCARSANVYPNFRPNTKTSLLGALFGIGPLIFWYYVFKTDRDRKEKLIQEGKLDRTFNISY

Entity 31 Entity 31 polymer

Description description	Mitochondrial complex I, B16.6 subunit
Molecular weight formula_weight	16635.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMRWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATIMKDVPGWKVGESVFHTTRWVTPMMGELYGLRTGEEILSSTYGFIWYT

Entity 32 Entity 32 polymer

Description description	Mitochondrial complex I, B17 subunit
Molecular weight formula_weight	15433.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

SGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

Entity 33 Entity 33 polymer

Description description	Mitochondrial complex I, B18 subunit
Molecular weight formula_weight	16282.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

GAHLARRYLGDASVEPEPLRMPTFPPDYGFPERKEREMVATQQEMNDAQLVLQQRDYCAHYLIRFLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRREQREADMAKGLGPGEVAPEVAL

Entity 34 Entity 34 polymer

Description description	Mitochondrial complex I, B22 subunit
Molecular weight formula_weight	21648.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

AFLPSAAYLTHQQKVLQLYKRALRHLESRCVHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEKEFWHGQHPQPYIFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTEALPPARKQGDLPPLWWHIVTRPRERPM

Entity 35 Entity 35 polymer

Description description	Mitochondrial complex I, AGGG subunit
Molecular weight formula_weight	8500.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

AGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

Entity 36 Entity 36 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	18818.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

ASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI

Entity 37 Entity 37 polymer

Description description	Mitochondrial complex I, ESSS subunit
Molecular weight formula_weight	14455.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDVWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPLMESNCFDPSKIQLPEDED

Entity 38 Entity 38 polymer

Description description	Mitochondrial complex I, KFYI subunit
Molecular weight formula_weight	5808.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

KFYIQEPPHGSPNWLKVGLTLGTSAFLWIYLIKQHNEDVLEYKRRNGLE

Entity 39 Entity 39 polymer

Description description	Mitochondrial complex I, MNLL subunit
Molecular weight formula_weight	6930.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MNLLQVVRDHWIHVLVPVGFVFGYYLDRKNDEKLAAFRNKSLLYKRELKPNEEVTWK

Entity 40 Entity 40 polymer

Description description	Mitochondrial complex I, MWFE subunit
Molecular weight formula_weight	8211.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERDRRVSGVNRYYVSKGLENID

Entity 41 Entity 41 polymer

Description description	Mitochondrial complex I, PDSW subunit
Molecular weight formula_weight	20880.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

PDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECHEKDVLCMFEAEMQWKRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELQQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKATKEAAAA

Entity 42 Entity 42 polymer

Description description	Mitochondrial complex I, PGIV subunit
Molecular weight formula_weight	20008.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

PGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKEQAQFDKCVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRARPEPNPEVEGDLKPARHGSRLFFWTM

Entity 43 Entity 43 polymer

Description description	Mitochondrial complex I, SGDH subunit
Molecular weight formula_weight	16714.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

SGDHGKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAEIPEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELRLKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN

Entity 44 Entity 44 polymer

Description description	Mitochondrial complex I, B14.7 subunit
Molecular weight formula_weight	10145.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 45 Entity 45 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 46 Entity 46 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 47 Entity 47 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 48 Entity 48 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 49 Entity 49 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 50 Entity 50 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 51 Entity 51 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 52 Entity 52 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 53 Entity 53 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 54 Entity 54 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

Domain ID domain_id	5lnk102
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11540 — NADH-ubiquinone oxidoreductase 51kDa subunit

Domain ID domain_id	5lnk103
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	600 —

Domain ID domain_id	5lnk104
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	230 — NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain

Domain ID domain_id	5lnk400
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	5lnk600
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	12280 —

Domain ID domain_id	5lnkA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1610 — NADH:ubiquinone/plastoquinone oxidoreductase, chain 3

Domain ID domain_id	5lnkJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	5lnkK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

Domain ID domain_id	5lnke00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	82000

Entire ovine respiratory complex I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial complex I, 51 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, 24 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, 75 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, 49 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, 30 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, ND1 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, ND2 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, ND3 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, ND4 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, ND4L subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer