6qc2

Ovine respiratory supercomplex I+III2 open class 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D3； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt O78747

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D1； PDBConstruct 1–318； UniProt 1–318

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt O78757

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D6； PDBConstruct 1–175； UniProt 1–175

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt O78754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_SHEEP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4L； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt O78756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D5； PDBConstruct 1–606； UniProt 1–606

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt O78755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_SHEEP
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D4； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt O78748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_SHEEP
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D2； PDBConstruct 1–347； UniProt 1–347

NDUFA11

OrganismNot specified

UniProt W5PAR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PAR2_SHEEP
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AK； PDBConstruct 1–140； UniProt 2–141

NADH:ubiquinone oxidoreductase subunit B5

OrganismNot specified

UniProt W5QHN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QHN8_SHEEP
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B5； PDBConstruct 1–143； UniProt 47–189

Acyl carrier protein

OrganismNot specified

UniProt W5NQT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NQT7_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AA； PDBConstruct 1–88； UniProt 70–157 Author chain AB； PDBConstruct 1–88； UniProt 70–157

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt W5PYA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PYA5_SHEEP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A8； PDBConstruct 1–171； UniProt 2–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt W5QBF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QBF5_SHEEP
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–320； UniProt 36–355

NADH:ubiquinone oxidoreductase subunit S5

OrganismNot specified

UniProt W5QFF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QFF9_SHEEP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain S5； PDBConstruct 1–105； UniProt 2–106

NADH:ubiquinone oxidoreductase subunit A3

OrganismNot specified

UniProt W5NYM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NYM7_SHEEP
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain A3； PDBConstruct 1–83； UniProt 2–84

NADH:ubiquinone oxidoreductase subunit B3

OrganismNot specified

UniProt W5Q5T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q5T4_SHEEP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain B3； PDBConstruct 1–97； UniProt 2–98

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt W5P9Q8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P9Q8_SHEEP
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain C2； PDBConstruct 1–120； UniProt 3–122

NADH:ubiquinone oxidoreductase subunit B4

OrganismNot specified

UniProt W5QF73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QF73_SHEEP
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain B4； PDBConstruct 1–128； UniProt 3–130

NDUFB6

OrganismNot specified

UniProt W5PZE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PZE3_SHEEP
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain B6； PDBConstruct 1–127； UniProt 2–128

NADH:ubiquinone oxidoreductase subunit B7

OrganismNot specified

UniProt W5P5V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P5V3_SHEEP
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain B7； PDBConstruct 1–119； UniProt 2–120

NADH:ubiquinone oxidoreductase subunit B9

OrganismNot specified

UniProt W5PGA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PGA3_SHEEP
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain B9； PDBConstruct 1–178； UniProt 2–179

NADH:ubiquinone oxidoreductase subunit B2

OrganismNot specified

UniProt W5PVD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PVD7_SHEEP
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain B2； PDBConstruct 1–72； UniProt 37–108

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt W5Q1B0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q1B0_SHEEP
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain B8； PDBConstruct 1–158； UniProt 29–186

NDUFB11

OrganismNot specified

UniProt W5PWF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PWF1_SHEEP
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BK； PDBConstruct 1–125； UniProt 30–154

NDUFB1

OrganismNot specified

UniProt W5QG39

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QG39_SHEEP
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain B1； PDBConstruct 1–57； UniProt 2–58

Ubiquinol-cytochrome c reductase core protein 2

OrganismNot specified

UniProt W5Q0F9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q0F9_SHEEP
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain a2； PDBConstruct 1–439； UniProt 15–453 Author chain a4； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P24959

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_SHEEP
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain b1； PDBConstruct 1–379； UniProt 1–379 Author chain b2； PDBConstruct 1–379； UniProt 1–379

Cytochrome c1

OrganismNot specified

UniProt W5Q0A9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q0A9_SHEEP
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain c1； PDBConstruct 1–240； UniProt 85–324 Author chain c2； PDBConstruct 1–240； UniProt 85–324

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt W5P2X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P2X9_SHEEP
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain f1； PDBConstruct 1–196； UniProt 79–274 Author chain f2； PDBConstruct 1–196； UniProt 79–274

Ubiquinol-cytochrome c reductase complex III subunit VII

OrganismNot specified

UniProt W5PUP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PUP9_SHEEP
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain q1； PDBConstruct 1–81； UniProt 2–82 Author chain q2； PDBConstruct 1–81； UniProt 2–82

Ubiquinol-cytochrome c reductase, complex III subunit X

OrganismNot specified

UniProt W5P6B2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P6B2_SHEEP
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain i1； PDBConstruct 1–63； UniProt 2–64 Author chain i2； PDBConstruct 1–63； UniProt 2–64

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

UniProt W5PUX0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PUX0_SHEEP
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain V1； PDBConstruct 1–445； UniProt 20–464

NDUFV2

OrganismNot specified

UniProt W5NRY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NRY1_SHEEP
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain V2； PDBConstruct 1–217； UniProt 30–246

NADH:ubiquinone oxidoreductase core subunit S1

OrganismNot specified

UniProt W5QB34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QB34_SHEEP
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain S1； PDBConstruct 1–704； UniProt 24–727

NADH:ubiquinone oxidoreductase core subunit S3

OrganismNot specified

UniProt W5PB27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PB27_SHEEP
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain S3； PDBConstruct 1–228； UniProt 39–266

NADH:ubiquinone oxidoreductase subunit S4

OrganismNot specified

UniProt W5PE07

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PE07_SHEEP
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain S4； PDBConstruct 1–133； UniProt 38–170

NADH:ubiquinone oxidoreductase subunit A9

OrganismNot specified

UniProt W5PI58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PI58_SHEEP
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain A9； PDBConstruct 1–338； UniProt 36–373

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt W5QAH8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QAH8_SHEEP
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain A2； PDBConstruct 1–98； UniProt 2–99

NDUFA5

OrganismNot specified

UniProt W5PNX7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PNX7_SHEEP
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain A5； PDBConstruct 1–115； UniProt 2–116

NADH:ubiquinone oxidoreductase subunit A6

OrganismNot specified

UniProt W5QC06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NDUFA7 × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QC06_SHEEP
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain A6； PDBConstruct 1–127； UniProt 14–140

NDUFA7

OrganismNot specified

UniProt W5P0I2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P0I2_SHEEP
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain A7； PDBConstruct 1–112； UniProt 3–114

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt B9VGZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 65	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NDUFA11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 2 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NDUFB10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NDUFA13 × 1 NDUFB6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NDUFB11 × 1 （W5PWF1） NDUFC1 × 1 NDUFB1 × 1 （W5QG39） NDUFA1 × 1 UQCRC1 × 2 Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） UQCRB × 2 Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） UQCRQH × 2 UQCRFS1N × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NDUFV2 × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） NDUFS2 × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） NDUFS7 × 1 NDUFS8 × 1 NDUFV3 × 1 NDUFS6 × 1 NADH:ubiquinone oxidoreductase subunit S4 × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NDUFA5 × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NDUFA7 × 1 （W5P0I2） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 CARDIOLIPIN × 3 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B9VGZ9_SHEEP
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain AL； PDBConstruct 1–145； UniProt 1–145

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qc2
Deposition date deposition_date	2018-12-26
Structure title title	Ovine respiratory supercomplex I+III2 open class 2
Keywords keywords	supercomplex, cellular respiration, mitochondria, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qc2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qc2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qc2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.98 Å
Rg (electron density)	86.34 Å
Total Rg	86.39 Å
Atom count	96938
Residues	12063
Excluded volume	1739400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qc2__assembly_1__model_1`	65-meric （65）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (65)

Entity 1 Entity 1 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13106.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D3
Atom count atom_count	96938

MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE

Entity 2 Entity 2 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	35884.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D1

MFMINVLTLIIPILLAVAFLTLVERKVLGYMQFRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHNPYMPELYTINFTIKSLLLSITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT

Entity 3 Entity 3 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	19126.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D6

MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

Entity 4 Entity 4 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10840.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4L

MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC

Entity 5 Entity 5 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68410.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D5

MNLFSSLTLVTLILLTMPIAAINFNTHKFTNYPLYVKTTISCAFITSMIPTMMFIHTGQEMIISNWHWLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLINLNTWDLQQIFMLNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKFGQSIMLCLGAMTTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGGLFKAMPFTTTALIIGSLALTGMPFLTGFYSKDLIIESANTSYTNAWALLMTLVATSFTAIYSTRIIFFALLGQPRFPTLININENNPFLINSIKRLLIGSLFAGFIISNNIPPMTIPQMTMPHYLKMTALTVTILGFILALEISNTTHYLKFNYPSNTFKFSNLLGYYPTIMHRLTPYMNLTMSQKSASSLLDLIWLETILPKTISLAQMKMSTTITSQKGLIKLYFLSFLITILISTTLLNFHE

Entity 6 Entity 6 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	52058.7 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D4

MLKYIIPTMMLMPLTWLSKNSMIWINTTLHSLLISLTSLLLLNQFGDNSLNFSLTFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLARKKLFISMLILLQLFLIMTFTATELIFFYIMFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTMGSLNFLILQYWVQPMPNSWSNTFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMMRITLLLNPITDFMAYPFIMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERVHSRTMILARGLQTLLPLMAAWWLLASLTNLALPPSINLIGELFVVMSTFSWSNITIILMGLNMVITALYSLYMLITTQRGKHTHHINNILPSFTRENALMSLHMLPLLLLSLNPKIILGPLY

Entity 7 Entity 7 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	39149.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D2

MNPIILIIILMTVMLGTIIVMISTHWLLIWIGFEMNMLAIIPIMMKKHNPRATEASTKYFLTQSTASMLLMMAIIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQILPSINLDLILTLSILSITIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLLYNPTMTLLNLIIYIIMTSTMFTLFMANSTTTTLSLSHTWNKAPIMTILVLITLLSMGGLPPLSGFMPKWMIIQEMTKNDSIILPTLMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPTTKRMTLLPTMTVLSTMLLPLTPILSILE

Entity 8 Entity 8 polymer

Description description	NDUFA11
Molecular weight formula_weight	14610.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

AKTLLHQYWDIPEGTECHRKTYAATSIGGASGLVVSAYSVALKTPTSFLEGVARTGRYTFTAAAIGAIFGLTSCISAQVREKPDDPLNYLIGGCAGGLTLGARTRSYGIGAAACAYMGLTAALVKMGQLEGWKVFAEPKV

Entity 9 Entity 9 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B5
Molecular weight formula_weight	16714.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

SGDHGKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAEIPEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELRLKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN

Entity 10 Entity 10 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	10119.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AA

SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20008.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A8

PGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKEQAQFDKCVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRARPEPNPEVEGDLKPARHGSRLFFWTM

Entity 12 Entity 12 polymer

Description description	NDUFB10
Molecular weight formula_weight	20880.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

PDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECHEKDVLCMFEAEMQWKRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELQQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKATKEAAAA

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	36803.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

LQYGPLAYILGEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGIHYADSTTGDGKPLPVRFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFIRKQCVDHYNQVKKVTVCEYLPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTFLPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQDDRKLHNLRMLVQDKLEVLNYTSIPVFLPEVTIGAHQSDRVFQEFTELPGRKYRAGYNEDVGDKWIWLK

Entity 14 Entity 14 polymer

Description description	NADH:ubiquinone oxidoreductase subunit S5
Molecular weight formula_weight	12474.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S5

PFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP

Entity 15 Entity 15 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A3
Molecular weight formula_weight	9194.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3

APRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL

Entity 16 Entity 16 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B3
Molecular weight formula_weight	11015.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

AHGHGHEHGPSKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAVGAEYYLESQKKDKKHH

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14231.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C2

MMTGRQARAPLQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSAGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYREVFEEFHPVR

Entity 18 Entity 18 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B4
Molecular weight formula_weight	14976.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

SFPKYEPSRLASLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYNDPSRRGVVEDPALIRWTCARSANVYPNFRPNTKTSLLGALFGIGPLIFWYYVFKTDRDRKEKLIQEGKLDRTFNISY

Entity 19 Entity 19 polymer

Description description	NDUFA13
Molecular weight formula_weight	16635.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMRWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATIMKDVPGWKVGESVFHTTRWVTPMMGELYGLRTGEEILSSTYGFIWYT

Entity 20 Entity 20 polymer

Description description	NDUFB6
Molecular weight formula_weight	15433.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6

SGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

Entity 21 Entity 21 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B7
Molecular weight formula_weight	14645.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B7

GAHLARRYLGDASVEPEPLRMPTFPPDYGFPERKEREMVATQQEMNDAQLVLQQRDYCAHYLIRFLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRREQREA

Entity 22 Entity 22 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B9
Molecular weight formula_weight	21648.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B9

AFLPSAAYLTHQQKVLQLYKRALRHLESRCVHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEKEFWHGQHPQPYIFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTEALPPARKQGDLPPLWWHIVTRPRERPM

Entity 23 Entity 23 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B2
Molecular weight formula_weight	8500.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

AGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	18818.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B8

ASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI

Entity 25 Entity 25 polymer

Description description	NDUFB11
Molecular weight formula_weight	14455.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDVWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPLMESNCFDPSKIQLPEDED

Entity 26 Entity 26 polymer

Description description	NDUFC1
Molecular weight formula_weight	5808.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1

KFYIQEPPHGSPNWLKVGLTLGTSAFLWIYLIKQHNEDVLEYKRRNGLE

Entity 27 Entity 27 polymer

Description description	NDUFB1
Molecular weight formula_weight	6930.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MNLLQVVRDHWIHVLVPVGFVFGYYLDRKNDEKLAAFRNKSLLYKRELKPNEEVTWK

Entity 28 Entity 28 polymer

Description description	NDUFA1
Molecular weight formula_weight	8211.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1

MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERDRRVSGVNRYYVSKGLENID

Entity 29 Entity 29 polymer

Description description	UQCRC1
Molecular weight formula_weight	49385.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a1,a3

TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYETEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLTPCRFTGSEIRHREDGLPLAHVAIAVEGPGWANPDNVALQVANAIIGHYDCTYGGGMHLSSPLASVAVTNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVVRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Entity 30 Entity 30 polymer

Description description	Ubiquinol-cytochrome c reductase core protein 2
Molecular weight formula_weight	46655.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a2,a4

SLKVAPKAKATAAPAGVPQHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENFNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQSQLRIDKAVAFQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPDELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYRGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGCQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Entity 31 Entity 31 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42877.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b1,b2

MINIRKTHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLETWNIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFIFPFIIAALAMVHLLFLHETGSNNPTGIPSDTDKIPFHPYYTIKDILGAILLILILMLLVLFTPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVLVIMPLLHTSKQRSMMFRPISQCMFWILVADLLTLTWIGGQPVEHPYIIIGQLASIMYFLIILVMMPVASIIENNLLKW

Entity 32 Entity 32 polymer

Description description	Cytochrome c1
Molecular weight formula_weight	27322.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c1,c2

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPRVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Entity 33 Entity 33 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21654.6 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f1,f2

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLITATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Entity 34 Entity 34 polymer

Description description	UQCRB
Molecular weight formula_weight	13432.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d1,d2

AGRPAVSASSKWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKFYLEPYLKEVIRERKEREEWTKK

Entity 35 Entity 35 polymer

Description description	Ubiquinol-cytochrome c reductase complex III subunit VII
Molecular weight formula_weight	9606.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q1,q2

GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVVFYLVYTWGTQEFEKSKRKNPAAYENDK

Entity 36 Entity 36 polymer

Description description	UQCRQH
Molecular weight formula_weight	9223.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h1,h2

GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK

Entity 37 Entity 37 polymer

Description description	UQCRFS1N
Molecular weight formula_weight	6656.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x1,x2

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 38 Entity 38 polymer

Description description	Ubiquinol-cytochrome c reductase, complex III subunit X
Molecular weight formula_weight	7310.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i1,i2

AAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 39 Entity 39 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	48678.3 kDa
EC 编号 ec_number	1.6.99.3,7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V1

FSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Entity 40 Entity 40 polymer

Description description	NDUFV2
Molecular weight formula_weight	23840.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V2

GAGGALFVHRDTPKNNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 41 Entity 41 polymer

Description description	NADH:ubiquinone oxidoreductase core subunit S1
Molecular weight formula_weight	77031.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S1

TATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTHTTWEDALSRVAGMLQSCQGNDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLQEAKKPMVVLGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCVTRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVMPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAHAVEEPSIC

Entity 42 Entity 42 polymer

Description description	NDUFS2
Molecular weight formula_weight	49193.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S2

ARQWQPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 43 Entity 43 polymer

Description description	NADH:ubiquinone oxidoreductase core subunit S3
Molecular weight formula_weight	26441.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S3

ESASADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFSELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPVESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPEAK

Entity 44 Entity 44 polymer

Description description	NDUFS7
Molecular weight formula_weight	20104.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S7

PSSTQPAVSQARAVVPKPAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR

Entity 45 Entity 45 polymer

Description description	NDUFS8
Molecular weight formula_weight	20219.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S8

TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 46 Entity 46 polymer

Description description	NDUFV3
Molecular weight formula_weight	8423.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V3

SAESGKNEKGLPPNPKKQSPPKKPASAAPTEPFDNTTYKNLQHHDYSTYTFLDLNLDLSKFRMPQPSSGRESPRH

Entity 47 Entity 47 polymer

Description description	NDUFS6
Molecular weight formula_weight	10651.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S6

GVRTSPTGEKVTHTGQVYDDEDYRRVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQHH

Entity 48 Entity 48 polymer

Description description	NADH:ubiquinone oxidoreductase subunit S4
Molecular weight formula_weight	15375.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S4

AQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAIAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 49 Entity 49 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A9
Molecular weight formula_weight	38660.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A9

LHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRNKAVGEKEVRETFPEATIIKPADIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPNRYLLFDLVQYVFAVAHRPFLPYPMPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDRTLPHLPGLEDLGVQATPLELKAIEVLRRHRTYRWLSSEIEDVQPAK

Entity 50 Entity 50 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	10966.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2

AAAAAIRGVRGKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSSKA

Entity 51 Entity 51 polymer

Description description	NDUFA5
Molecular weight formula_weight	13156.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A5

AGLLKKTTGLVGLAVCETPHERLKILYTKILDVLGHIPKNAAYRKYTEQITNEKLSIVKAEPDVKKLEEQLQGGQIEEVILQAENELSLARKMIQWKPWEPLVEEPPASQWKWPI

Entity 52 Entity 52 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A6
Molecular weight formula_weight	14923.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A6

AASGLRQAAVAASTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDISVKQGRDKVREMFKKNAHVTDPRVVDLLVIKGKMELEETINVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 53 Entity 53 polymer

Description description	NDUFA7
Molecular weight formula_weight	12399.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A7

ASATRLIQGLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHRLSNNYYCARDGRREAMPPSIVMSSQKVLVAGKPAESSAVAASEKKAVSPAPPIKRWELSQDEPYL

Entity 54 Entity 54 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17115.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MELLQVLKRGLQQVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTVKPPTARKFIWTNHKFNLSGTPQQYVPYSTTRKKIQEWVPPSTPYK

Entity 55 Entity 55 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 56 Entity 56 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 57 Entity 57 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 58 Entity 58 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 59 Entity 59 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 60 Entity 60 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 61 Entity 61 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 62 Entity 62 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 63 Entity 63 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 64 Entity 64 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 65 Entity 65 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	30836

Ovine respiratory supercomplex I+III2 open class 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NDUFA11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase subunit B5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer