6q9e

Complex III2 focused refinement from Ovine respiratory supercomplex I+III2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome c reductase core protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q5G6_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a1； PDBConstruct 1–446； UniProt 35–483 Author chain a3； PDBConstruct 1–446； UniProt 35–483

Ubiquinol-cytochrome c reductase core protein 2

OrganismNot specified

UniProt W5Q0F9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q0F9_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a2； PDBConstruct 1–439； UniProt 15–453 Author chain a4； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P24959

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain b1； PDBConstruct 1–379； UniProt 1–379 Author chain b2； PDBConstruct 1–379； UniProt 1–379

Cytochrome c1

OrganismNot specified

UniProt W5Q0A9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q0A9_SHEEP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain c1； PDBConstruct 1–240； UniProt 85–324 Author chain c2； PDBConstruct 1–240； UniProt 85–324

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt W5P2X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P2X9_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain f1； PDBConstruct 1–196； UniProt 79–274 Author chain f2； PDBConstruct 1–196； UniProt 79–274

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt W5P642

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P642_SHEEP
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain d1； PDBConstruct 2–110； UniProt 1–109 Author chain d2； PDBConstruct 2–110； UniProt 1–109

Ubiquinol-cytochrome c reductase complex III subunit VII

OrganismNot specified

UniProt W5PUP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PUP9_SHEEP
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain q1； PDBConstruct 1–81； UniProt 2–82 Author chain q2； PDBConstruct 1–81； UniProt 2–82

Cytochrome b-c1 complex subunit 6

OrganismNot specified

UniProt W5PZC9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 Ubiquinol-cytochrome c reductase, complex III subunit X × 2 （W5P6B2） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PZC9_SHEEP
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain h1； PDBConstruct 1–78； UniProt 14–91 Author chain h2； PDBConstruct 1–78； UniProt 14–91

Ubiquinol-cytochrome c reductase, complex III subunit X

OrganismNot specified

UniProt W5P6B2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome c reductase core protein 1 × 2 （W5Q5G6） Ubiquinol-cytochrome c reductase core protein 2 × 2 （W5Q0F9） Cytochrome b × 2 （P24959） Cytochrome c1 × 2 （W5Q0A9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （W5P2X9） Cytochrome b-c1 complex subunit 7 × 2 （W5P642） Ubiquinol-cytochrome c reductase complex III subunit VII × 2 （W5PUP9） Cytochrome b-c1 complex subunit 6 × 2 （W5PZC9） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CARDIOLIPIN × 5 UBIQUINONE-10 × 3 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P6B2_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain i1； PDBConstruct 1–63； UniProt 2–64 Author chain i2； PDBConstruct 1–63； UniProt 2–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6q9e
Deposition date deposition_date	2018-12-18
Structure title title	Complex III2 focused refinement from Ovine respiratory supercomplex I+III2
Keywords keywords	complex III, cellular respiration, mitochondria, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6q9e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6q9e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6q9e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.20 Å
Rg (electron density)	54.35 Å
Total Rg	54.50 Å
Atom count	31997
Residues	3988
Excluded volume	571190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6q9e__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Ubiquinol-cytochrome c reductase core protein 1
Molecular weight formula_weight	49385.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a1,a3
Atom count atom_count	31997

TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYETEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLTPCRFTGSEIRHREDGLPLAHVAIAVEGPGWANPDNVALQVANAIIGHYDCTYGGGMHLSSPLASVAVTNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVVRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Ubiquinol-cytochrome c reductase core protein 2
Molecular weight formula_weight	46655.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a2,a4

SLKVAPKAKATAAPAGVPQHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENFNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQSQLRIDKAVAFQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPDELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYRGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGCQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42877.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b1,b2

MINIRKTHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLETWNIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFIFPFIIAALAMVHLLFLHETGSNNPTGIPSDTDKIPFHPYYTIKDILGAILLILILMLLVLFTPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVLVIMPLLHTSKQRSMMFRPISQCMFWILVADLLTLTWIGGQPVEHPYIIIGQLASIMYFLIILVMMPVASIIENNLLKW

Entity 4 Entity 4 polymer

Description description	Cytochrome c1
Molecular weight formula_weight	27322.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c1,c2

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPRVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21654.6 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f1,f2

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLITATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13432.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d1,d2

AGRPAVSASSKWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKFYLEPYLKEVIRERKEREEWTKK

Entity 7 Entity 7 polymer

Description description	Ubiquinol-cytochrome c reductase complex III subunit VII
Molecular weight formula_weight	9606.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q1,q2

GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVVFYLVYTWGTQEFEKSKRKNPAAYENDK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6
Molecular weight formula_weight	9223.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h1,h2

GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	2826.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x1,x2

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Ubiquinol-cytochrome c reductase, complex III subunit X
Molecular weight formula_weight	7310.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i1,i2

AAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 11 Entity 11 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 14 Entity 14 non-polymer

Description description	UBIQUINONE-10
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 15 Entity 15 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	102314

Complex III2 focused refinement from Ovine respiratory supercomplex I+III2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome c reductase core protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome c reductase core protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome c reductase complex III subunit VII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome c reductase, complex III subunit X

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6q9e__assembly_1__model_1

6q9e__assembly_1__model_1 | I(q)

6q9e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment