SAXSdb — 5lx2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

KLTH0G14146p

Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phosphatidylinositol 4-kinase beta × 2 （A0A0B4J1S8） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C5DN49_LACTC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–253； UniProt 1–253

Phosphatidylinositol 4-kinase beta

OrganismNot specified

UniProt A0A0B4J1S8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	KLTH0G14146p × 2 （C5DN49） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0B4J1S8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–6； UniProt 304–309

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5lx2
Deposition date deposition_date	2016-09-19
Structure title title	Lt 14-3-3 in complex with PI4KIIIB peptide
Keywords keywords	phosphoserin, kinase, regulation, transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5lx2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5lx2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5lx2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.57 Å
Rg (electron density)	26.69 Å
Total Rg	27.42 Å
Atom count	3794
Residues	480
Excluded volume	67078 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5lx2__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	KLTH0G14146p
Molecular weight formula_weight	28603.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1927

MSQSREDSVYLAKLAEQAERYEEMVDSMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEAKDKSEHQVKLIRDYRSKIETELTKICDDILSVLDTHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGEVRDKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSEAGQDEQQPAEGAQE

Source Source

Source organism organism	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	559295
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Phosphatidylinositol 4-kinase beta
Molecular weight formula_weight	697.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TASNPK

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	30

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	5lx2A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

▶

Unit-cell length a length_a	64.063 Å
Unit-cell length b length_b	123.671 Å
Unit-cell length c length_c	38.688 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.579 Å
Low-resolution limit resolution_low	44.491 Å
R factor r_factor	0.2057
R_work r_work	0.2027
R_free r_free	0.2627

Lt 14-3-3 in complex with PI4KIIIB peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

KLTH0G14146p

State in the Current Structure

Other States of the Same Protein in the Database

Phosphatidylinositol 4-kinase beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5lx2__assembly_1__model_1

5lx2__assembly_1__model_1 | I(q)

5lx2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Lt 14-3-3 in complex with PI4KIIIB peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

KLTH0G14146p

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phosphatidylinositol 4-kinase beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5lx2__assembly_1__model_1

5lx2__assembly_1__model_1 | I(q)

5lx2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)