SAXSdb — 5owx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

Foot-and-mouth disease virus (strain A10-61)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_FMDV1
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain 1； PDBConstruct 1–182； UniProt 752–933 Author chain 2； PDBConstruct 1–182； UniProt 315–496 Author chain 3； PDBConstruct 1–221； UniProt 505–725

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5owx
Deposition date deposition_date	2017-09-04
Structure title title	Inside-out FMDV A10 capsid
Keywords keywords	Virus, FMDV, A10, CryoEM, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5owx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5owx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5owx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.05 Å
Rg (electron density)	28.01 Å
Total Rg	28.81 Å
Atom count	4439
Residues	564
Excluded volume	78972 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5owx__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	20085.9 kDa
EC 编号 ec_number	3.4.22.46,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	4439

RHHTDVGFIMDRFVKINSLSPTHVIDLMQTHKHGIVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKAPFTRLALPYTAPHRVLATVYDGTNKYSASDSRSGDLGSTAARVATQLPASFNYGAIQAQAIHELLVRMKRAELYCPRPLLAIKVTSQDRYKQKIIAPA

Source Source

Source organism organism	Foot-and-mouth disease virus (strain A10-61)
NCBI taxonomy ID ncbi_taxonomy_id	12112
Host organism host_organism	Cricetinae gen. sp.

Entity 2 Entity 2 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	20701.5 kDa
EC 编号 ec_number	3.4.22.46,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SVGVTYGYSTEEDHVAGPNTSGLETRVVQAERFFKKFLFDWTTDKPFGYLTKLELPTDHHGVFGHLVDSYAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKAFDTREKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVLSPLTVSNTAAPQIKVYANIAPTYVHV

Source Source

Source organism organism	Foot-and-mouth disease virus (strain A10-61)
NCBI taxonomy ID ncbi_taxonomy_id	12112
Host organism host_organism	Cricetinae gen. sp.

Entity 3 Entity 3 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	24234.0 kDa
EC 编号 ec_number	3.4.22.46,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GIFPVACADGYGGLVTTDPKTADPVYGKVYNPPKTNYPGRFTNLLDVAEACPTFLRFDDGKPYVVTRADDTRLLAKFDVSLAAKHMSNTYLSGIAQYYTQYSGTINLHFMFTGSTDSKARYMVAYIPPGVETPPDTPEEAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDTAETTNVQGWVCVYQITHGKAENDTLLVSASAGKDFELRLPIDPRTQ

Source Source

Source organism organism	Foot-and-mouth disease virus (strain A10-61)
NCBI taxonomy ID ncbi_taxonomy_id	12112
Host organism host_organism	Cricetinae gen. sp.

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	8077

Inside-out FMDV A10 capsid

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5owx__assembly_1__model_1

5owx__assembly_1__model_1 | I(q)

5owx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Inside-out FMDV A10 capsid

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5owx__assembly_1__model_1

5owx__assembly_1__model_1 | I(q)

5owx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)