5tfl

Crystal Structure of Mouse Cadherin-23 EC7+8

Method: X-RAY DIFFRACTION D_max: 111.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cadherin-23

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 666–886	Fragment：Cadherin domains 7-8, residues 666-886	NA SODIUM ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.7；277 K；0.1 M Sodium Acetate pH 4.7, 1.9 M Sodium Chloride, 30% PEG 400	Resolution 3.56 Å R-free 0.221
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 666–886	Fragment：Cadherin domains 7-8, residues 666-886	NA SODIUM ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.7；277 K；0.1 M Sodium Acetate pH 4.7, 1.9 M Sodium Chloride, 30% PEG 400	Resolution 3.56 Å R-free 0.221

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5TFL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2WBX Crystal structure of mouse cadherin-23 EC1 Deposited 2009-03-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–124（101 aa） Fragment：EC1, RESIDUES 24-124	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.1 M SODIUM CACODYLATE PH 6.0 40% MPD	Resolution 1.50 Å R-free 0.199
2WCP CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 Deposited 2009-03-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 3 NA SODIUM ION × 3 CL CHLORIDE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；2.7M NACL,0.1M TRIS HCL,PH 8.0, 10% GLYCEROL	Resolution 1.98 Å R-free 0.188
2WD0 CRYSTAL STRUCTURE OF NONSYNDROMIC DEAFNESS (DFNB12) ASSOCIATED MUTANT D124G OF MOUSE CADHERIN-23 EC1-2 Deposited 2009-03-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Mutation：YES	CA CALCIUM ION × 3 NA SODIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；0.1M SODIUM CACODYLATE PH 7.1, 1M NACL	Resolution 2.74 Å R-free 0.249
2WD0 CRYSTAL STRUCTURE OF NONSYNDROMIC DEAFNESS (DFNB12) ASSOCIATED MUTANT D124G OF MOUSE CADHERIN-23 EC1-2 Deposited 2009-03-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Mutation：YES	CA CALCIUM ION × 3 NA SODIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；0.1M SODIUM CACODYLATE PH 7.1, 1M NACL	Resolution 2.74 Å R-free 0.249
2WHV CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 (ALL CATION BINDING SITES OCCUPIED BY CALCIUM) Deposited 2009-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 4 K POTASSIUM ION × 4 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES PH 6.5, 1.1 M CALCIUM CHLORIDE DIHYDRATE, 0.15 M POTASSIUM CHLORIDE	Resolution 2.36 Å R-free 0.221
3MVS Structure of the N-terminus of Cadherin 23 Deposited 2010-05-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–233（210 aa） Fragment：UNP residues 24-233	Not recorded	CA CALCIUM ION × 6 EDO 1,2-ETHANEDIOL × 22	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；200 nl of 6.9 mg/ml protein in 1 mM CaCl2, 50 mM Tris-HCl, pH 8.5, 200 nl crystallant (22.5% ethylene glycol and 0.2 M NDSB-201), VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.10 Å R-free 0.188
4APX CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM I Deposited 2012-04-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 CL CHLORIDE ION × 1 K POTASSIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1M MES, 8% PEG8000, PH6.5	Resolution 1.65 Å R-free 0.193
4AQ8 CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM II Deposited 2012-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 MES, 10% PEG 8000, PH 7.5	Resolution 2.63 Å R-free 0.243
4AQ8 CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM II Deposited 2012-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 MES, 10% PEG 8000, PH 7.5	Resolution 2.63 Å R-free 0.243
4AQA CRYSTAL STRUCTURE OF DEAFNESS ASSOCIATED MUTANT MOUSE CADHERIN-23 EC1- 2D124G AND PROTOCADHERIN-15 EC1-2 FORM I Deposited 2012-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Mutation：YES	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 CL CHLORIDE ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 MES, 8% PEG 20000, PH 6.5	Resolution 1.96 Å R-free 0.228
4AQE CRYSTAL STRUCTURE OF DEAFNESS ASSOCIATED MUTANT MOUSE CADHERIN-23 EC1- 2S70P AND PROTOCADHERIN-15 EC1-2 FORM I Deposited 2012-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Mutation：YES	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES, 12% PEG 4000, PH 6.5	Resolution 2.27 Å R-free 0.239
4AXW CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2, FORM I 2.2A. Deposited 2012-06-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–228（205 aa） Fragment：EC1-2, RESIDUES 24-228	Not recorded	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 PG4 TETRAETHYLENE GLYCOL × 1 CL CHLORIDE ION × 1 GOL GLYCEROL × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES PH 6.5, 15% W/V PEG550MME, 25% GLYCEROL, 0.2M POTASSIUM CHLORIDE	Resolution 2.23 Å R-free 0.236
4XXW Crystal structure of mouse Cadherin-23 EC1-2 and Protocadherin-15 EC1-2 splice variant Deposited 2015-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 24–228（205 aa）	Not recorded	CA CALCIUM ION × 7 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.2 M Ammonium Acetate 0.1 M HEPES, pH 7.5 25% (v/v) isopropanol	Resolution 2.26 Å R-free 0.233
4XXW Crystal structure of mouse Cadherin-23 EC1-2 and Protocadherin-15 EC1-2 splice variant Deposited 2015-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 24–228（205 aa）	Not recorded	CA CALCIUM ION × 7 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.2 M Ammonium Acetate 0.1 M HEPES, pH 7.5 25% (v/v) isopropanol	Resolution 2.26 Å R-free 0.233
5I8D Crystal Structure of Mouse Cadherin-23 EC19-21 S2064P Deposited 2016-02-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1949–2289（341 aa）	Mutation：S2087P	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；277 K；0.025M Calcium Acetate, 0.1 M Sodium Cacodylate, 25% MPD	Resolution 2.69 Å R-free 0.253
5TFK Crystal Structure of Mouse Cadherin-23 EC19-21 WT Deposited 2016-09-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1949–2289（341 aa） Fragment：Cadherin domains 19-21, residues 1949-2289	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；277 K；0.1 M Sodium Cacodylate pH 6.2, 0.075 M Calcium Acetate, 28% MPD	Resolution 2.80 Å R-free 0.244
5ULU Crystal Structure of Mouse Cadherin-23 EC19-21 (S2087P) with non-syndromic deafness (DFNB12) associated mutation D2148N Deposited 2017-01-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1955–2289（335 aa） Fragment：residues 1955-2289	Mutation：S2087P, D2148N	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.1 M Tris pH 8.5 0.05M MgCl2 25% MPD	Resolution 2.85 Å R-free 0.244
5UN2 Crystal Structure of Mouse Cadherin-23 EC19-21 with non-syndromic deafness (DFNB12) associated mutation R2029W Deposited 2017-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1955–2289（335 aa） Fragment：residues 1955-2289	Mutation：R2029W	CA CALCIUM ION × 8 K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；277 K；0.1 M HEPES pH 7.3 0.1 M CaCl2 27% PEG 400 5% glycerol	Resolution 2.96 Å R-free 0.236
5UZ8 Crystal Structure of Mouse Cadherin-23 EC22-24 Deposited 2017-02-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2288–2607（320 aa） Fragment：residues 2288-2607	Not recorded	CL CHLORIDE ION × 3 CA CALCIUM ION × 7 GSH Glutathione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M HEPES pH 7.5 3.5 M Ammonium Chloride	Resolution 1.85 Å R-free 0.188
5VH2 Crystal Structure of Mouse Cadherin-23 EC12-13 with Engineered Mutation S1339D Deposited 2017-04-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1202–1412（211 aa） Fragment：residues 1202-1412	Mutation：S1339D	CA CALCIUM ION × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.05 M Tris pH 8.5 0.5 M NaCl 22% PEG 4000	Resolution 2.84 Å R-free 0.272
5VH2 Crystal Structure of Mouse Cadherin-23 EC12-13 with Engineered Mutation S1339D Deposited 2017-04-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1202–1412（211 aa） Fragment：residues 1202-1412	Mutation：S1339D	CA CALCIUM ION × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.05 M Tris pH 8.5 0.5 M NaCl 22% PEG 4000	Resolution 2.84 Å R-free 0.272
5VH2 Crystal Structure of Mouse Cadherin-23 EC12-13 with Engineered Mutation S1339D Deposited 2017-04-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1202–1412（211 aa） Fragment：residues 1202-1412	Mutation：S1339D	CA CALCIUM ION × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.05 M Tris pH 8.5 0.5 M NaCl 22% PEG 4000	Resolution 2.84 Å R-free 0.272
5VH2 Crystal Structure of Mouse Cadherin-23 EC12-13 with Engineered Mutation S1339D Deposited 2017-04-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1202–1412（211 aa） Fragment：residues 1202-1412	Mutation：S1339D	CA CALCIUM ION × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.05 M Tris pH 8.5 0.5 M NaCl 22% PEG 4000	Resolution 2.84 Å R-free 0.272
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 2504–2715（212 aa） Fragment：residues 2504-2715 Chain D 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5VT8 Crystal Structure of Mouse Cadherin-23 EC24-25 Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2504–2715（212 aa） Fragment：residues 2504-2715 Chain C 2504–2715（212 aa） Fragment：residues 2504-2715	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.9；277 K；0.1 M TRIS pH 7.9 10% PEG 8000	Resolution 2.92 Å R-free 0.221
5WJM Crystal Structure of Mouse Cadherin-23 EC17-18 Deposited 2017-07-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1739–1954（216 aa） Fragment：residues 1739-1954	Not recorded	CA CALCIUM ION × 6 K POTASSIUM ION × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；277 K；0.1 M NaOAc pH 5.2 0.01 M MgCl2 25 % (v/v) MPD 25 mM 18-Crown-6 0.07 M CaCl2	Resolution 2.90 Å R-free 0.266
6N2E Crystal Structure of Human Protocadherin-15 EC1-3 G16D N369D Q370N and Mouse Cadherin-23 EC1-2 T15E Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 24–228（205 aa） Chain D 24–228（205 aa）	Mutation：T15E Mutation：T15E	CA CALCIUM ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M Imidazole pH 6.8, 46% MPD	Resolution 2.90 Å R-free 0.253
7SKH Crystal Structure of Mouse Cadherin-23 EC16-17 Deposited 2021-10-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1630–1847（218 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；0.1 M MMT pH 9.0 25% PEG 1500	Resolution 2.27 Å R-free 0.252
7SKH Crystal Structure of Mouse Cadherin-23 EC16-17 Deposited 2021-10-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1630–1847（218 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；0.1 M MMT pH 9.0 25% PEG 1500	Resolution 2.27 Å R-free 0.252
7SUU Crystal Structure of Mouse Cadherin-23 EC25-26 Deposited 2021-11-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2603–2842（240 aa）	Not recorded	CA CALCIUM ION × 6 K POTASSIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；0.1 M HEPES ph 7.8 0.35 M CaCl2 28 % PEG 400	Resolution 2.25 Å R-free 0.253
7SUU Crystal Structure of Mouse Cadherin-23 EC25-26 Deposited 2021-11-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2603–2842（240 aa）	Not recorded	CA CALCIUM ION × 8 K POTASSIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；0.1 M HEPES ph 7.8 0.35 M CaCl2 28 % PEG 400	Resolution 2.25 Å R-free 0.253
7T3S Crystal Structure of Mouse Cadherin-23 EC8-9 Deposited 2021-12-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 770–991（222 aa）	Not recorded	CA CALCIUM ION × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M NaCl 20% PEG 3350	Resolution 2.97 Å R-free 0.299
7T80 Crystal Structure of Mouse Cadherin-23 EC18-19 Deposited 2021-12-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1847–2063（217 aa）	Not recorded	CA CALCIUM ION × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.2 M (NH4)2SO4 25% w/v PEG 3350 0.1 M Tris-HCl 8.5 pH	Resolution 2.30 Å R-free 0.232
7T80 Crystal Structure of Mouse Cadherin-23 EC18-19 Deposited 2021-12-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1847–2063（217 aa）	Not recorded	CA CALCIUM ION × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.2 M (NH4)2SO4 25% w/v PEG 3350 0.1 M Tris-HCl 8.5 pH	Resolution 2.30 Å R-free 0.232
7U71 Crystal Structure of Mouse Cadherin-23 EC13-15 Deposited 2022-03-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 1308–1628（321 aa） Fragment：UNP residuess 1308-1628	Not recorded	CA CALCIUM ION × 6 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M HEPES pH7.5 0.2 M NaOAc 20% PEG 3000	Resolution 1.98 Å R-free 0.221
7UQU Crystal Structure of Mouse Cadherin-23 EC9 Deposited 2022-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 883–991（109 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M Magnesium Chloride 20% PEG 3350	Resolution 1.98 Å R-free 0.224
7UQU Crystal Structure of Mouse Cadherin-23 EC9 Deposited 2022-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain BBB 883–991（109 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M Magnesium Chloride 20% PEG 3350	Resolution 1.98 Å R-free 0.224
8TRI Crystal Structure of Mouse Cadherin-23 EC25-MAD28 F2894A Deposited 2023-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2603–3065（463 aa） Fragment：residues 2603-3065	Mutation：F2894A	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；277 K；1.25 M Lithium Acetate, 0.1 M MES pH 7.2, 25% glycerol (cryo)	Resolution 3.72 Å R-free 0.229
8TRI Crystal Structure of Mouse Cadherin-23 EC25-MAD28 F2894A Deposited 2023-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2603–3065（463 aa） Fragment：residues 2603-3065	Mutation：F2894A	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；277 K；1.25 M Lithium Acetate, 0.1 M MES pH 7.2, 25% glycerol (cryo)	Resolution 3.72 Å R-free 0.229
8TRI Crystal Structure of Mouse Cadherin-23 EC25-MAD28 F2894A Deposited 2023-08-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2603–3065（463 aa） Fragment：residues 2603-3065	Mutation：F2894A	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；277 K；1.25 M Lithium Acetate, 0.1 M MES pH 7.2, 25% glycerol (cryo)	Resolution 3.72 Å R-free 0.229

27 other PDB entries and 44 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CAD23_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–222； UniProt 666–886 Author chain B； PDBConstruct 2–222； UniProt 666–886

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5tfl
Deposition date deposition_date	2016-09-25
Structure title title	Crystal Structure of Mouse Cadherin-23 EC7+8
Keywords keywords	hearing, mechanotransduction, adhesion, calcium-binding protein, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.87 Å
Radius of gyration Rg (electron density) rg_electron	29.94 Å
Forward intensity I(0) i0	31016400.00
Molecular weight molecular_weight	44022.0 kDa
Excluded volume excluded_volume	55491 Å³
Envelope volume envelope_volume	71531 Å³
Hydration-shell volume shell_volume	22464 Å³
Envelope diameter envelope_diameter	118.0 Å
Shell Rg shell_rg	32.73 Å
Envelope Rg envelope_rg	30.38 Å
Shape Rg shape_rg	29.95 Å
Total Rg total_rg	30.19 Å
Total atoms total_atoms	3090
Residues n_residues	400
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	111.3 Å
Rg (real space) rg_real	30.16 Å
Rg uncertainty (real space) rg_real_error	1.32 Å
I(0) (real space) i0_real	3.1020e+07
I(0) uncertainty (real space) i0_real_error	5.2020e+05
Rg (reciprocal space) rg_reciprocal	30.04 Å
I(0) (reciprocal space) i0_reciprocal	31010000.0000
Solution quality estimate total_estimate	0.8152
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	35.7 Å
Skewness Skewness skewness	0.549
Kurtosis Kurtosis kurtosis	-0.075
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1905000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.658; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.646; Smooth: 0.974

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cadherin-23
Molecular weight formula_weight	25528.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3093

MDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNLEHHHHHH

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	5tflA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	60 — Cadherins

Domain ID domain_id	5tflB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	60 — Cadherins

▶

8. Citations (1)

▶

Unit-cell length a length_a	185.809 Å
Unit-cell length b length_b	185.809 Å
Unit-cell length c length_c	185.809 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 3 2
Space-group number int_tables_number	213
Crystal system crystal_system	—

Resolution resolution	3.560 Å
Low-resolution limit resolution_low	131.390 Å
R factor r_factor	0.1938
R_work r_work	0.1924
R_free r_free	0.2214

fit	/app/data/saxs_computation/tf/5tfl/5tfl.fit
pddf	/app/data/pr_computation/tf/5tfl/5tfl.pr.out
profile	/app/data/saxs_computation/tf/5tfl/5tfl.dat