5u0p

Cryo-EM structure of the transcriptional Mediator

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator complex subunit 14

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED14_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain N； PDBConstruct 1–879； UniProt 1–879

Mediator complex subunit 6

OrganismNot specified

UniProt Q9US45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED6_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–216； UniProt 1–216

Mediator complex subunit 8

OrganismNot specified

UniProt O94646

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED8_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–200； UniProt 1–200

Mediator complex subunit 17

OrganismNot specified

UniProt P87306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED17_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Q； PDBConstruct 1–545； UniProt 1–545

Mediator complex subunit 18

OrganismNot specified

UniProt O14198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain R； PDBConstruct 1–207； UniProt 1–207

Mediator complex subunit 20

OrganismNot specified

UniProt Q10317

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED20_SCHPO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain T； PDBConstruct 1–193； UniProt 1–193

Mediator complex subunit 11

OrganismNot specified

UniProt Q9P6Q0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED11_SCHPO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–111； UniProt 1–111

Mediator complex subunit 22

OrganismNot specified

UniProt O14010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED22_SCHPO
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain V； PDBConstruct 1–136； UniProt 1–136

Mediator complex subunit 7

OrganismNot specified

UniProt O60104

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED7_SCHPO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G； PDBConstruct 1–376； UniProt 1–376

Mediator complex subunit 21

OrganismNot specified

UniProt O94376

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED21_SCHPO
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain U； PDBConstruct 1–138； UniProt 1–138

Mediator complex subunit 31

OrganismNot specified

UniProt Q9USH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED31_SCHPO
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 3； PDBConstruct 1–139； UniProt 1–139

Mediator complex subunit 9

OrganismNot specified

UniProt O13964

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 27 × 1 （Q10477） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YE44_SCHPO
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–121； UniProt 1–121

Mediator complex subunit 27

OrganismNot specified

UniProt Q10477

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Mediator complex subunit 14 × 1 （Q9P7Y4） Mediator complex subunit 6 × 1 （Q9US45） Mediator complex subunit 8 × 1 （O94646） Mediator complex subunit 17 × 1 （P87306） Mediator complex subunit 18 × 1 （O14198） Mediator complex subunit 20 × 1 （Q10317） Mediator complex subunit 11 × 1 （Q9P6Q0） Mediator complex subunit 22 × 1 （O14010） Mediator complex subunit 4 × 1 Mediator complex subunit 7 × 1 （O60104） Mediator complex subunit 21 × 1 （O94376） Mediator complex subunit 31 × 1 （Q9USH1） Mediator complex subunit 9 × 1 （O13964） Mediator complex subunit 19 × 1 Mediator complex subunit 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED27_SCHPO
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2； PDBConstruct 1–273； UniProt 1–273

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5u0p
Deposition date deposition_date	2016-11-26
Structure title title	Cryo-EM structure of the transcriptional Mediator
Keywords keywords	transcription, transcriptional, Mediator, Head, Middle, Tail, Srb, RNA polymerase II, Med; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5u0p__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5u0p__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5u0p__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.76 Å
Rg (electron density)	64.46 Å
Total Rg	63.82 Å
Atom count	20268
Residues	2929
Excluded volume	353030 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5u0p__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Mediator complex subunit 14
Molecular weight formula_weight	105382.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N
Atom count atom_count	20268

MEPPAIPHITEGFYPLPEIVETFSHHVLQELVSLAEVLPSMSNVEKKKKILDWLLRSRAFTMRLLVLARWVHLSPSVHRCIDVVAFLQGQKFCFQNLVHVLQDIRYQLSFARLRNSDLVTALDILSTGTSLRLANAPTSKLYMLSESPLSTKQILQTLHALNMLIRIRLSLYEIIPTPFQHFTIANGRCTFTVPNEFSVSLTTNSQDPKSTGISFQWIVVDFQFHLPDFSSTPAKYRVFIELHLNEEIAAAFVLQKPILPLIYNILHKFCLYQRLNLLSQQTFQLSRESWLGHLRGVYDEKPPRLRLYYWPQLNVKKEGKPGKIGHYIHIFVNTQPISAFERTLSSKRSSCEYDHFLLLVEWHHDGIVEHVPLDDHMDAQHLLLLITQKHAQLILEQIRKELHPNIFSEHVGGGLKIHVFDNEIIVKVNSVTGRLVLSSSASPLSPPRHLRAAEKNIALNTQPPAQILNRLYFFCIQTQLLEVAQCAELHAVQGYYSFPYLTFSKGKWRKDGDSLWVLAYNVESNSWSVRLLNAAGQTLYTQDVHTTKGTLSIESFSRLSYLLEVQILLFNVQTACQARGMPFEYLPIPPKALIEDDFTTYVQTGCLCIMMPSSNEDMLPVVFVRAHDGQLIFDSRIKGKLPYQSETETEKNCYIDWRTGRITIRVQNFSSFEKTWIGLLKLVALSKTSAFNVDCITLKHVDFTYLDDEKFRATIHDDNTFTLHFFNRHSPFHLISQFLQDTFSDGPSAIQPLRVIMDRTRGVLVAQELGYVVLARSLRQYRIILSKNHGIQVLLNRHGCILQDLSYLSADSRYLEGTQTLTSQWEPCSWLNTVWEGDLGDDELNGQIEAAPEMHLIKMNKTADLTAILKRILAISRKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 2 Entity 2 polymer

Description description	Mediator complex subunit 6
Molecular weight formula_weight	24928.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MASGAPPSVDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIEKFPQYNPQEGYTYPKLSNDNLEVDHSNTNEPADENKNQSIENADYSFSPEDFSVVRAFMQSLHSSKEAPDVK

Entity 3 Entity 3 polymer

Description description	Mediator complex subunit 8
Molecular weight formula_weight	23360.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR

Entity 4 Entity 4 polymer

Description description	Mediator complex subunit 17
Molecular weight formula_weight	62551.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAEEANKDADISSLSLSLDPEIIGGQNNFLENNLQQIFQKIIQERGPFRDLKEEDLQKELQKESIKDESSAKSSETENVLEFATLDSKRNVNDTEVESMDSQAYKKELIEQIMIAQTECSLALDMTSLLLSKFKENSIETISPFLKSTVPPSSLQFSRSQPPESKESDATLAKCWKEKSLTSSCKFLFEAKERLTSVVETEHEYYTELVKVKEASWPLFNSQGSNHLSVQYSCLGGISLGLGLIRMKPESKSFEVQSSLLYSQAALKISILNKDRDEIGSSTWSWPSQNCNSVLLKDIYKLQEILFEMDIWNSLLQEAQSCGNQGVNFTGDEILVPISDDHVVRITLETSSKNTESGFTEDKKSNEDTSTNFVTIKQEKELLKCLCDTLNAIAHILFLKHCRKSDRRSQQPELYMAIDANAPLILRPLIFYYNLNQESLEFQRWLKQRDISFKFMPNYPWEKAKDFLELENSLSINRLSISWRIMVSNFEPAIFIQHTPTLHGTDKSVWRCKDQYSSNQFSSLKNVCQYIEHHINSLSRRSKKTE

Entity 5 Entity 5 polymer

Description description	Mediator complex subunit 18
Molecular weight formula_weight	24056.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MQELYLLGVVPSRRFEAVVNSLSKTLDGPKTILEFWVVYRPKDVPPNLPRQPDSWLRLCSNIESHDETDTEWSKNTQWSMYLEGNSEPKREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFHPMNEEQPWILHVYTHVADASNQVAMAKAEANLTKVKTLLSAFCDLKNVRL

Entity 6 Entity 6 polymer

Description description	Mediator complex subunit 20
Molecular weight formula_weight	22374.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MPVHGVIYYSSPSMATFLSPAQDNLVRTYFAQHLKKWVVQYKLYRNAVTPKTLEFLKQNINPSMLACVDEATMIDAEPELEDIIVRTKLWNFRQSFTIEGSIYEVGSFKVAIANVLQKSVWKGILFHVTYDGTESVDLARPIIQEFFLKCFLQNNKSVTPVYESFFNQPRHSLDSKLLLQLFKQRIDTVSQRT

Entity 7 Entity 7 polymer

Description description	Mediator complex subunit 11
Molecular weight formula_weight	13118.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTNSDDDLFSEKSTSSDTQQVQNILELEAKIPDILSSAGKCIEAIQLNNSLEDFRKYSKEFLETVEFISTGLRRQALELEKAEVPVVSLQPKKRYASTPLSNLIFDQSSKLIPKYC

Entity 8 Entity 8 polymer

Description description	Mediator complex subunit 22
Molecular weight formula_weight	15396.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT

Entity 9 Entity 9 polymer

Description description	Mediator complex subunit 4
Molecular weight formula_weight	20358.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	Mediator complex subunit 7
Molecular weight formula_weight	43573.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MEPNEGVQLFSAFPPPPPYYKLFTRENIEKVISNMEKEAKHEDDANTLQPKTEEEIESLAKLFKKPSCLTSGTYQMFGDTWRLDEAIPSLKEFGIPELYKDIKDGEDEIEVVEYDPKSNAIVGTSFTRVHDYDKNSPIENEKILEDDQHTAMKEKDNESDKTMKDVEEKTEPSLKKEEEDIQMKEPLDSQDTGAVSASSVNEGFRADQKSKDGETSDLIKIPRRAYELRFLSRSLMLNFLELLGIMAKAPEQFPSKVENIRVLLLNLHHLINDYRPHQSRESLIMLLEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRSMFSKNDEKLKKSLELMEDVIKRDLS

Entity 11 Entity 11 polymer

Description description	Mediator complex subunit 21
Molecular weight formula_weight	15821.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MACRCTQLQDTIDEVATQFYSSIHYLSSHHDFVPLPGQEKVSDSKVNPISAEELQFAQRDLAKDLVTKFMQIDTLINQLPGISTAPKHQLEKIKKLQNSIEEKQLERKSLESENEDLKLQLAKRIETFGRLSCVLFQP

Entity 12 Entity 12 polymer

Description description	Mediator complex subunit 31
Molecular weight formula_weight	16914.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE

Entity 13 Entity 13 polymer

Description description	Mediator complex subunit 9
Molecular weight formula_weight	13811.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MDPAHHIKDTSAELLSQQDFSILQSRLLEFLASQEARETVTASKELTLLRQGIRQLKEKVSKMEPEEMTVKEKKSIIEILKARIALKKAFLKMALSESNDTVVKKEDVRESPVDTFMENAT

Entity 14 Entity 14 polymer

Description description	Mediator complex subunit 27
Molecular weight formula_weight	31132.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MSLEEQRTRDELKHKLLDLNQLHEQLAELRTICPSLLKLLHPETGTSRKFEKSAQEAIEKVNSFYTHLKSSQNVFDYAEKSLQADSSNLLPTYLYNSEDLSNDTENNETKSINGKSALDLKEPHHSELHDNDNFQNSDINIESFKGDIEASGSILTTHENKSFTLKLANELEFIFFHDTRGKFSVYCSSSKDDAITFSINRNNNFLGNLWSLMPKILDYQHLYSKPCDFCKSLISPVYLELPSVRRNANSTVKPTSKDILALHAECVPAQSDL

Entity 15 Entity 15 polymer

Description description	Mediator complex subunit 19
Molecular weight formula_weight	11847.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 16 Entity 16 polymer

Description description	Mediator complex subunit 10
Molecular weight formula_weight	11251.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	42484

Cryo-EM structure of the transcriptional Mediator

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator complex subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator complex subunit 21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer