5uk4

VESICULAR STOMATITS VIRUS N PROTEIN IN COMPLEX WITH INHIBITORY NANOBODY 1307

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

Vesicular stomatitis Indiana virus (strain San Juan)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 20 RNA 2	Anti-vesicular stomatitis virus N VHH × 10 （A0A192B6J6） RNA (45-MER) × 2	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 20 RNA 2	Anti-vesicular stomatitis virus N VHH × 10 （A0A192B6J6） RNA (45-MER) × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCAP_VSIVA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–422； UniProt 1–422 Author chain B； PDBConstruct 1–422； UniProt 1–422 Author chain C； PDBConstruct 1–422； UniProt 1–422 Author chain D； PDBConstruct 1–422； UniProt 1–422 Author chain E； PDBConstruct 1–422； UniProt 1–422 Author chain F； PDBConstruct 1–422； UniProt 1–422 Author chain G； PDBConstruct 1–422； UniProt 1–422 Author chain H； PDBConstruct 1–422； UniProt 1–422 Author chain I； PDBConstruct 1–422； UniProt 1–422 Author chain J； PDBConstruct 1–422； UniProt 1–422 Author chain K； PDBConstruct 1–422； UniProt 1–422 Author chain L； PDBConstruct 1–422； UniProt 1–422 Author chain M； PDBConstruct 1–422； UniProt 1–422 Author chain N； PDBConstruct 1–422； UniProt 1–422 Author chain O； PDBConstruct 1–422； UniProt 1–422 Author chain P； PDBConstruct 1–422； UniProt 1–422 Author chain Q； PDBConstruct 1–422； UniProt 1–422 Author chain R； PDBConstruct 1–422； UniProt 1–422 Author chain S； PDBConstruct 1–422； UniProt 1–422 Author chain T； PDBConstruct 1–422； UniProt 1–422

Anti-vesicular stomatitis virus N VHH

Vicugna pacos

UniProt A0A192B6J6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 20 RNA 2	Nucleoprotein × 10 （P03521） RNA (45-MER) × 2	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 20 RNA 2	Nucleoprotein × 10 （P03521） RNA (45-MER) × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A192B6J6_VICPA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–125； UniProt 1–125 Author chain b； PDBConstruct 1–125； UniProt 1–125 Author chain c； PDBConstruct 1–125； UniProt 1–125 Author chain d； PDBConstruct 1–125； UniProt 1–125 Author chain e； PDBConstruct 1–125； UniProt 1–125 Author chain f； PDBConstruct 1–125； UniProt 1–125 Author chain g； PDBConstruct 1–125； UniProt 1–125 Author chain h； PDBConstruct 1–125； UniProt 1–125 Author chain i； PDBConstruct 1–125； UniProt 1–125 Author chain j； PDBConstruct 1–125； UniProt 1–125 Author chain k； PDBConstruct 1–125； UniProt 1–125 Author chain l； PDBConstruct 1–125； UniProt 1–125 Author chain m； PDBConstruct 1–125； UniProt 1–125 Author chain n； PDBConstruct 1–125； UniProt 1–125 Author chain o； PDBConstruct 1–125； UniProt 1–125 Author chain p； PDBConstruct 1–125； UniProt 1–125 Author chain q； PDBConstruct 1–125； UniProt 1–125 Author chain r； PDBConstruct 1–125； UniProt 1–125 Author chain s； PDBConstruct 1–125； UniProt 1–125 Author chain t； PDBConstruct 1–125； UniProt 1–125

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5uk4
Deposition date deposition_date	2017-01-19
Structure title title	VESICULAR STOMATITS VIRUS N PROTEIN IN COMPLEX WITH INHIBITORY NANOBODY 1307
Keywords keywords	VESICULAR STOMATITIS VIRUS, NUCLEOPROTEIN, INHIBITORY VHH, ANTIVIRAL, Viral Protein-RNA-Immune System complex; Viral Protein/RNA/Immune System
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5uk4__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5uk4__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5uk4__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.66 Å
Rg (electron density)	61.32 Å
Total Rg	61.43 Å
Atom count	44467
Residues	5508
Excluded volume	784860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5uk4__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5uk4__assembly_2__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Nucleoprotein
Molecular weight formula_weight	47463.9 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,B,Q,C,R,D,S,E,T,K,L,N,M,F,G,H,I,O,J,A
Atom count atom_count	89086

MSVTVKRIIDNTVIVPKLPANEDPVEYPADYFRKSKEIPLYINTTKSLSDLRGYVYQGLKSGNVSIIHVNSYLYGALKDIRGKLDKDWSSFGINIGKAGDTIGIFDLVSLKALDGVLPDGVSDASRTSADDKWLPLYLLGLYRVGRTQMPEYRKKLMDGLTNQCKMINEQFEPLVPEGRDIFDVWGNDSNYTKIVAAVDMFFHMFKKHECASFRYGTIVSRFKDCAALATFGHLCKITGMSTEDVTTWILNREVADEMVQMMLPGQEIDKADSYMPYLIDFGLSSKSPYSSVKNPAFHFWGQLTALLLRSTRARNARQPDDIEYTSLTTAGLLYAYAVGSSADLAQQFCVGDNKYTPDDSTGGLTTNAPPQGRDVVEWLGWFEDQNRKPTPDMMQYAKRAVMSLQGLREKTIGKYAKSEFDK

Source Source

Source organism organism	Vesicular stomatitis Indiana virus (strain San Juan)
Common name common_name	VSIV
NCBI taxonomy ID ncbi_taxonomy_id	11285
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Anti-vesicular stomatitis virus N VHH
Molecular weight formula_weight	15277.9 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p,b,q,c,r,d,s,e,t,k,l,n,m,f,g,h,i,o,j,a

QVQLVETGGGLVQTGGSLRLSCKASGRTFSNSIMGWFRQAPGKERDFVAKISWRNDYTTYADSVKGRFTISRDNASNMVYLLMNNLKPEDTAVYYCAATKAYNGGETSGRGFYYWGQGTQVTVSSGGLPETGGHHHHHH

Source Source

Source organism organism	Vicugna pacos
Common name common_name	Alpaca
NCBI taxonomy ID ncbi_taxonomy_id	30538
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	RNA (45-MER)
Molecular weight formula_weight	13732.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	u,v,w,x

UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU

Source Source

Source organism organism	Vicugna pacos
NCBI taxonomy ID ncbi_taxonomy_id	30538
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

Domain ID domain_id	5uk4A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4A02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4B02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4C01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4C02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4D01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4D02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4E01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4E02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4F01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4F02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4G02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4H01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4H02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4I01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4I02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4J01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4J02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4K01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4K02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4L01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4L02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4M01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4M02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4N01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4N02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4O01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4O02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4P01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4P02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4Q01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4Q02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4R01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4R02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4S01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4S02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4T01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3570 — Rhabdovirus nucleoprotein-like fold
Homologous superfamily homologous superfamily	10 — Rhabdovirus nucleocapsid protein like domain

Domain ID domain_id	5uk4T02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3610 — Rhabdovirus nucleoprotein-like
Homologous superfamily homologous superfamily	10 — Nucleoprotein

Domain ID domain_id	5uk4a00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4b00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4c00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4d00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4e00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4f00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4g00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4h00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4i00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4j00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4k00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4l00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4m00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4n00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4o00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4p00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4q00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4r00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4s00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5uk4t00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	147.555 Å
Unit-cell length b length_b	156.008 Å
Unit-cell length c length_c	217.450 Å
Unit-cell angle α angle_alpha	79.24 °
Unit-cell angle β angle_beta	75.66 °
Unit-cell angle γ angle_gamma	62.27 °
Molecules per unit cell Z z_pdb	20

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.204 Å
Low-resolution limit resolution_low	128.352 Å
R factor r_factor	0.2370
R_work r_work	0.2365
R_free r_free	0.2877

VESICULAR STOMATITS VIRUS N PROTEIN IN COMPLEX WITH INHIBITORY NANOBODY 1307

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Anti-vesicular stomatitis virus N VHH

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5uk4__assembly_2__model_1

5uk4__assembly_2__model_1 | I(q)

5uk4__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

7. Citations (1)

VESICULAR STOMATITS VIRUS N PROTEIN IN COMPLEX WITH INHIBITORY NANOBODY 1307

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anti-vesicular stomatitis virus N VHH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5uk4__assembly_2__model_1

5uk4__assembly_2__model_1 | I(q)

5uk4__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

7. Citations (1)